Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4398828..4399497 | Replicon | chromosome |
Accession | NZ_OX461105 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QOT07_RS20470 | Protein ID | WP_099063843.1 |
Coordinates | 4398828..4399250 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A2X2G343 |
Locus tag | QOT07_RS20475 | Protein ID | WP_037418284.1 |
Coordinates | 4399231..4399497 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS20450 | 4394712..4395230 | + | 519 | WP_085118696.1 | flavodoxin FldB | - |
QOT07_RS20455 | 4395271..4396635 | - | 1365 | WP_283603825.1 | cell envelope integrity protein CreD | - |
QOT07_RS20460 | 4396718..4398136 | - | 1419 | WP_283603826.1 | two-component system sensor histidine kinase CreC | - |
QOT07_RS20465 | 4398133..4398828 | - | 696 | WP_085118700.1 | two-component system response regulator CreB | - |
QOT07_RS20470 | 4398828..4399250 | - | 423 | WP_099063843.1 | protein YgfX | Toxin |
QOT07_RS20475 | 4399231..4399497 | - | 267 | WP_037418284.1 | FAD assembly factor SdhE | Antitoxin |
QOT07_RS20480 | 4399821..4400813 | + | 993 | WP_099063844.1 | tRNA-modifying protein YgfZ | - |
QOT07_RS20485 | 4400899..4401573 | - | 675 | WP_085118705.1 | hemolysin III family protein | - |
QOT07_RS20490 | 4401757..4402365 | + | 609 | WP_099063845.1 | HD domain-containing protein | - |
QOT07_RS20495 | 4402416..4403741 | - | 1326 | WP_219016887.1 | MFS transporter | - |
QOT07_RS20500 | 4403738..4404391 | - | 654 | WP_219016888.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16439.32 Da Isoelectric Point: 10.5155
>T297066 WP_099063843.1 NZ_OX461105:c4399250-4398828 [Serratia proteamaculans]
VAQWRCDVRISWRTQLLSLLTHGALILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLENQRLGWHGQ
EWQLVKQPWMPRYGILLTLQPVGGKKRRRLWLASDAMAKADWRHLRQQLLYPPASDDEEP
VAQWRCDVRISWRTQLLSLLTHGALILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLENQRLGWHGQ
EWQLVKQPWMPRYGILLTLQPVGGKKRRRLWLASDAMAKADWRHLRQQLLYPPASDDEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|