Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH |
Location | 4390449..4391175 | Replicon | chromosome |
Accession | NZ_OX461105 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QOT07_RS20425 | Protein ID | WP_283603824.1 |
Coordinates | 4390449..4390835 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QOT07_RS20430 | Protein ID | WP_085118688.1 |
Coordinates | 4390828..4391175 (+) | Length | 116 a.a. |
Genomic Context
Location: 4385472..4386086 (615 bp)
Type: Others
Protein ID: WP_283603822.1
Type: Others
Protein ID: WP_283603822.1
Location: 4386083..4387312 (1230 bp)
Type: Others
Protein ID: WP_283603823.1
Type: Others
Protein ID: WP_283603823.1
Location: 4390449..4390835 (387 bp)
Type: Toxin
Protein ID: WP_283603824.1
Type: Toxin
Protein ID: WP_283603824.1
Location: 4390828..4391175 (348 bp)
Type: Antitoxin
Protein ID: WP_085118688.1
Type: Antitoxin
Protein ID: WP_085118688.1
Location: 4394712..4395230 (519 bp)
Type: Others
Protein ID: WP_085118696.1
Type: Others
Protein ID: WP_085118696.1
Location: 4387569..4389086 (1518 bp)
Type: Others
Protein ID: WP_207979420.1
Type: Others
Protein ID: WP_207979420.1
Location: 4391221..4392954 (1734 bp)
Type: Others
Protein ID: WP_099063838.1
Type: Others
Protein ID: WP_099063838.1
Location: 4392961..4393677 (717 bp)
Type: Others
Protein ID: WP_099063839.1
Type: Others
Protein ID: WP_099063839.1
Location: 4393705..4394604 (900 bp)
Type: Others
Protein ID: WP_099063840.1
Type: Others
Protein ID: WP_099063840.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS20400 | 4385472..4386086 | + | 615 | WP_283603822.1 | 2OG-Fe dioxygenase family protein | - |
QOT07_RS20405 | 4386083..4387312 | + | 1230 | WP_283603823.1 | cysteine desulfurase-like protein | - |
QOT07_RS20415 | 4387569..4389086 | - | 1518 | WP_207979420.1 | lysine--tRNA ligase | - |
QOT07_RS20425 | 4390449..4390835 | + | 387 | WP_283603824.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOT07_RS20430 | 4390828..4391175 | + | 348 | WP_085118688.1 | helix-turn-helix domain-containing protein | Antitoxin |
QOT07_RS20435 | 4391221..4392954 | - | 1734 | WP_099063838.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QOT07_RS20440 | 4392961..4393677 | - | 717 | WP_099063839.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QOT07_RS20445 | 4393705..4394604 | - | 900 | WP_099063840.1 | site-specific tyrosine recombinase XerD | - |
QOT07_RS20450 | 4394712..4395230 | + | 519 | WP_085118696.1 | flavodoxin FldB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14809.80 Da Isoelectric Point: 7.9006
>T297065 WP_283603824.1 NZ_OX461105:4390449-4390835 [Serratia proteamaculans]
MDIFVTDDFDKFMRKNRIFDQRICVAAQEIMHDRHDGDLGGGVYKKRIPINQGKRGGARSVVAFKRGHHQYFVDGWLKNT
VKQTGAKEISDDELETYRELARDFLAMSPEIIQRAVDSGYLREVKCNE
MDIFVTDDFDKFMRKNRIFDQRICVAAQEIMHDRHDGDLGGGVYKKRIPINQGKRGGARSVVAFKRGHHQYFVDGWLKNT
VKQTGAKEISDDELETYRELARDFLAMSPEIIQRAVDSGYLREVKCNE
Download Length: 387 bp
Antitoxin
Download Length: 116 a.a. Molecular weight: 13034.05 Da Isoelectric Point: 11.1355
>AT297065 WP_085118688.1 NZ_OX461105:4390828-4391175 [Serratia proteamaculans]
MNDNRLLRLQKMAQRFNAIGAVSDETVRNIEARVQERESNVRREQAQMMDGARIKMLRERLGLSQADLAAVVNMSTTSVQ
KWERNAVKPQGSALRMLEIIEQKGVASVIISPLDR
MNDNRLLRLQKMAQRFNAIGAVSDETVRNIEARVQERESNVRREQAQMMDGARIKMLRERLGLSQADLAAVVNMSTTSVQ
KWERNAVKPQGSALRMLEIIEQKGVASVIISPLDR
Download Length: 348 bp