Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4021566..4022218 | Replicon | chromosome |
Accession | NZ_OX461105 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QOT07_RS18715 | Protein ID | WP_099062615.1 |
Coordinates | 4021566..4021952 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QOT07_RS18720 | Protein ID | WP_112348659.1 |
Coordinates | 4021955..4022218 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS18700 | 4018034..4019464 | + | 1431 | WP_283603729.1 | MFS transporter | - |
QOT07_RS18705 | 4019461..4020843 | + | 1383 | WP_099062613.1 | two-component system sensor histidine kinase BaeS | - |
QOT07_RS18710 | 4020843..4021559 | + | 717 | WP_219016796.1 | two-component system response regulator BaeR | - |
QOT07_RS18715 | 4021566..4021952 | - | 387 | WP_099062615.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QOT07_RS18720 | 4021955..4022218 | - | 264 | WP_112348659.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QOT07_RS18725 | 4022573..4022911 | + | 339 | WP_099062617.1 | YegP family protein | - |
QOT07_RS18730 | 4023090..4024442 | + | 1353 | WP_099062618.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
QOT07_RS18735 | 4024931..4025848 | + | 918 | WP_283603730.1 | lipid kinase YegS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14192.53 Da Isoelectric Point: 9.5368
>T297064 WP_099062615.1 NZ_OX461105:c4021952-4021566 [Serratia proteamaculans]
MYMFDTNTVSQLFRRHPRLLRVMEKIPPSAVCISSITEAELLYGVAKRQSLALKATVAAFLDSVTVYAWDREAAHCYGTM
RADMAKKGRVMGALDQLIAAHAQSRGATIVTNDKAFAMVPGLRVEDWT
MYMFDTNTVSQLFRRHPRLLRVMEKIPPSAVCISSITEAELLYGVAKRQSLALKATVAAFLDSVTVYAWDREAAHCYGTM
RADMAKKGRVMGALDQLIAAHAQSRGATIVTNDKAFAMVPGLRVEDWT
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|