Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 3987870..3988337 | Replicon | chromosome |
| Accession | NZ_OX461105 | ||
| Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QOT07_RS18600 | Protein ID | WP_283603720.1 |
| Coordinates | 3987870..3988139 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QOT07_RS18605 | Protein ID | WP_099062595.1 |
| Coordinates | 3988143..3988337 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOT07_RS18570 | 3983064..3983579 | + | 516 | WP_129936911.1 | E3 ubiquitin--protein ligase | - |
| QOT07_RS18575 | 3983610..3983858 | + | 249 | WP_006316897.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| QOT07_RS18580 | 3983911..3985200 | - | 1290 | WP_112348682.1 | uracil permease | - |
| QOT07_RS18585 | 3985262..3985888 | - | 627 | WP_017893631.1 | uracil phosphoribosyltransferase | - |
| QOT07_RS18590 | 3986144..3987181 | + | 1038 | WP_085118131.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| QOT07_RS18595 | 3987181..3987819 | + | 639 | WP_283603719.1 | phosphoribosylglycinamide formyltransferase | - |
| QOT07_RS18600 | 3987870..3988139 | - | 270 | WP_283603720.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QOT07_RS18605 | 3988143..3988337 | - | 195 | WP_099062595.1 | hypothetical protein | Antitoxin |
| QOT07_RS18610 | 3988484..3989038 | + | 555 | WP_099062596.1 | spermidine N1-acetyltransferase | - |
| QOT07_RS18615 | 3989117..3989929 | - | 813 | WP_085118133.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| QOT07_RS18620 | 3989958..3991610 | - | 1653 | WP_283603721.1 | phosphate ABC transporter permease PstA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10522.14 Da Isoelectric Point: 6.6437
>T297063 WP_283603720.1 NZ_OX461105:c3988139-3987870 [Serratia proteamaculans]
MRIEWSSEAQEELWSIIDYIDDRNPQAARKLHREIEAVVLTLPLNPLMHRLGRVDNTREIVVHPNYLVVYRVIGHIEVLS
VIHAKREYP
MRIEWSSEAQEELWSIIDYIDDRNPQAARKLHREIEAVVLTLPLNPLMHRLGRVDNTREIVVHPNYLVVYRVIGHIEVLS
VIHAKREYP
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|