Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 3563423..3564013 | Replicon | chromosome |
Accession | NZ_OX461105 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | QOT07_RS16685 | Protein ID | WP_085117561.1 |
Coordinates | 3563423..3563755 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | QOT07_RS16690 | Protein ID | WP_085117562.1 |
Coordinates | 3563756..3564013 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS16670 | 3559272..3559958 | + | 687 | WP_099064588.1 | two-component response regulator DpiA | - |
QOT07_RS16675 | 3560072..3563161 | + | 3090 | WP_283603601.1 | beta-galactosidase | - |
QOT07_RS16685 | 3563423..3563755 | - | 333 | WP_085117561.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QOT07_RS16690 | 3563756..3564013 | - | 258 | WP_085117562.1 | antitoxin | Antitoxin |
QOT07_RS16695 | 3564361..3564567 | - | 207 | WP_207978181.1 | helix-turn-helix transcriptional regulator | - |
QOT07_RS16700 | 3564564..3565025 | - | 462 | WP_207978179.1 | hypothetical protein | - |
QOT07_RS16705 | 3565411..3566673 | + | 1263 | WP_283603604.1 | hypothetical protein | - |
QOT07_RS16710 | 3566917..3567276 | + | 360 | Protein_3266 | ketopantoate reductase C-terminal domain-containing protein | - |
QOT07_RS16715 | 3567560..3568537 | + | 978 | WP_283603605.1 | DUF1852 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11796.66 Da Isoelectric Point: 10.4550
>T297062 WP_085117561.1 NZ_OX461105:c3563755-3563423 [Serratia proteamaculans]
MNRGEIWLVSLDPIAGHEQSGKRPVLIVSTASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGVKTTGVIRCDQPRTI
DMGARNGRRLECIPNNVVNEVLARLEAILT
MNRGEIWLVSLDPIAGHEQSGKRPVLIVSTASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGVKTTGVIRCDQPRTI
DMGARNGRRLECIPNNVVNEVLARLEAILT
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|