Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 467613..468187 | Replicon | chromosome |
Accession | NZ_OX461105 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QOT07_RS02165 | Protein ID | WP_283602484.1 |
Coordinates | 467909..468187 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QOT07_RS02160 | Protein ID | WP_085119515.1 |
Coordinates | 467613..467900 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS02135 | 463374..464459 | - | 1086 | WP_261285470.1 | carbon-phosphorus lyase complex subunit PhnI | - |
QOT07_RS02140 | 464459..465040 | - | 582 | WP_283602482.1 | phosphonate C-P lyase system protein PhnH | - |
QOT07_RS02145 | 465044..465487 | - | 444 | WP_099064523.1 | phosphonate C-P lyase system protein PhnG | - |
QOT07_RS02150 | 465488..466213 | - | 726 | WP_283604269.1 | phosphonate metabolism transcriptional regulator PhnF | - |
QOT07_RS02155 | 466450..467508 | + | 1059 | WP_283602483.1 | permease | - |
QOT07_RS02160 | 467613..467900 | + | 288 | WP_085119515.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QOT07_RS02165 | 467909..468187 | + | 279 | WP_283602484.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOT07_RS02170 | 468190..468654 | - | 465 | WP_283602485.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QOT07_RS02175 | 468715..470853 | - | 2139 | WP_207978075.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QOT07_RS02180 | 471126..472034 | - | 909 | WP_262261554.1 | LysR family transcriptional regulator | - |
QOT07_RS02185 | 472139..472663 | + | 525 | WP_283602486.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10690.35 Da Isoelectric Point: 4.6437
>T297054 WP_283602484.1 NZ_OX461105:467909-468187 [Serratia proteamaculans]
MRVEWDDEALLDRERIFDFLYPFNPQAAEQADSEIDKAVKRLLDYPELGKIWYGQARKLLISQASLLVLYVVVGDVIKVL
AVAHQREKFPDL
MRVEWDDEALLDRERIFDFLYPFNPQAAEQADSEIDKAVKRLLDYPELGKIWYGQARKLLISQASLLVLYVVVGDVIKVL
AVAHQREKFPDL
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|