Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 286542..287154 | Replicon | chromosome |
| Accession | NZ_OX461090 | ||
| Organism | Streptococcus agalactiae isolate MRI Z2-336 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8G2N8L3 |
| Locus tag | OWO33_RS01700 | Protein ID | WP_000384860.1 |
| Coordinates | 286542..286877 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | OWO33_RS01705 | Protein ID | WP_000259017.1 |
| Coordinates | 286867..287154 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWO33_RS01675 | 281740..282381 | + | 642 | WP_000591144.1 | hypothetical protein | - |
| OWO33_RS01680 | 282681..283556 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| OWO33_RS01685 | 283592..284026 | + | 435 | WP_001220479.1 | hypothetical protein | - |
| OWO33_RS01690 | 284343..285599 | + | 1257 | WP_000122836.1 | MobV family relaxase | - |
| OWO33_RS01695 | 285767..286237 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| OWO33_RS01700 | 286542..286877 | - | 336 | WP_000384860.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OWO33_RS01705 | 286867..287154 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| OWO33_RS01710 | 287661..287951 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| OWO33_RS01715 | 288053..288460 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| OWO33_RS01720 | 288460..289020 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| OWO33_RS01725 | 288993..289673 | + | 681 | WP_001865565.1 | hypothetical protein | - |
| OWO33_RS01730 | 289658..290044 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| OWO33_RS01735 | 290078..290359 | + | 282 | WP_000052406.1 | hypothetical protein | - |
| OWO33_RS01740 | 291202..292062 | + | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 192477..288440 | 95963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13227.87 Da Isoelectric Point: 4.5348
>T297048 WP_000384860.1 NZ_OX461090:c286877-286542 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|