Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 240586..241198 | Replicon | chromosome |
Accession | NZ_OX460985 | ||
Organism | Streptococcus agalactiae isolate MRI Z2-307 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q8E7D3 |
Locus tag | QOR59_RS01400 | Protein ID | WP_000384859.1 |
Coordinates | 240586..240921 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q8E7D2 |
Locus tag | QOR59_RS01405 | Protein ID | WP_000259017.1 |
Coordinates | 240911..241198 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOR59_RS01375 | 235784..236425 | + | 642 | WP_000591144.1 | hypothetical protein | - |
QOR59_RS01380 | 236725..237600 | + | 876 | WP_000421240.1 | hypothetical protein | - |
QOR59_RS01385 | 237636..238070 | + | 435 | WP_001220479.1 | hypothetical protein | - |
QOR59_RS01390 | 238387..239643 | + | 1257 | WP_000122836.1 | MobV family relaxase | - |
QOR59_RS01395 | 239811..240281 | + | 471 | WP_000130119.1 | hypothetical protein | - |
QOR59_RS01400 | 240586..240921 | - | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOR59_RS01405 | 240911..241198 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
QOR59_RS01410 | 241706..241996 | + | 291 | WP_000078282.1 | WXG100 family type VII secretion target | - |
QOR59_RS01415 | 242098..242505 | + | 408 | WP_000749955.1 | hypothetical protein | - |
QOR59_RS01420 | 242505..243092 | + | 588 | WP_011074703.1 | hypothetical protein | - |
QOR59_RS01425 | 243038..243716 | + | 679 | Protein_228 | hypothetical protein | - |
QOR59_RS01430 | 243701..244087 | + | 387 | WP_000259072.1 | hypothetical protein | - |
QOR59_RS01435 | 244121..244402 | + | 282 | WP_000052404.1 | hypothetical protein | - |
QOR59_RS01440 | 245245..246105 | + | 861 | WP_000471421.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T297044 WP_000384859.1 NZ_OX460985:c240921-240586 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|