Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 240197..240809 Replicon chromosome
Accession NZ_OX460984
Organism Streptococcus agalactiae isolate MRI Z2-172

Toxin (Protein)


Gene name parE Uniprot ID Q8E1X3
Locus tag QOR68_RS01420 Protein ID WP_000384858.1
Coordinates 240197..240532 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q8E1X2
Locus tag QOR68_RS01425 Protein ID WP_000255538.1
Coordinates 240522..240809 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOR68_RS01395 235394..236023 + 630 WP_000591152.1 hypothetical protein -
QOR68_RS01400 236336..237211 + 876 WP_000421239.1 hypothetical protein -
QOR68_RS01405 237247..237681 + 435 WP_001220480.1 hypothetical protein -
QOR68_RS01410 237998..239254 + 1257 WP_000122832.1 MobV family relaxase -
QOR68_RS01415 239422..239892 + 471 WP_000130119.1 hypothetical protein -
QOR68_RS01420 240197..240532 - 336 WP_000384858.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOR68_RS01425 240522..240809 - 288 WP_000255538.1 hypothetical protein Antitoxin
QOR68_RS01430 241316..241606 + 291 WP_000078283.1 WXG100 family type VII secretion target -
QOR68_RS01435 241708..242114 + 407 Protein_227 hypothetical protein -
QOR68_RS01440 242114..242290 + 177 WP_001868321.1 hypothetical protein -
QOR68_RS01445 242308..242673 + 366 WP_001868327.1 hypothetical protein -
QOR68_RS01450 242646..243326 + 681 WP_001865565.1 hypothetical protein -
QOR68_RS01455 243311..243697 + 387 WP_000259069.1 hypothetical protein -
QOR68_RS01460 243731..244012 + 282 WP_000052406.1 hypothetical protein -
QOR68_RS01465 244855..245715 + 861 WP_000477654.1 Rgg/GadR/MutR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 231934..241073 9139


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-109)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13264.04 Da        Isoelectric Point: 5.2388

>T297043 WP_000384858.1 NZ_OX460984:c240532-240197 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10921.47 Da        Isoelectric Point: 4.7271

>AT297043 WP_000255538.1 NZ_OX460984:c240809-240522 [Streptococcus agalactiae]
MVTAEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRSELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E1EF10

Antitoxin

Source ID Structure
AlphaFold DB A0A0E1EFF9

References