Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1293048..1293965 | Replicon | chromosome |
Accession | NZ_OX460973 | ||
Organism | Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | QOS64_RS06715 | Protein ID | WP_007407256.1 |
Coordinates | 1293219..1293965 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | QOS64_RS06710 | Protein ID | WP_003154807.1 |
Coordinates | 1293048..1293218 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS64_RS06675 (1288281) | 1288281..1289903 | + | 1623 | WP_076423972.1 | pyocin knob domain-containing protein | - |
QOS64_RS06680 (1289916) | 1289916..1290287 | + | 372 | WP_136396299.1 | XkdW family protein | - |
QOS64_RS06685 (1290292) | 1290292..1290489 | + | 198 | WP_007610833.1 | XkdX family protein | - |
QOS64_RS06690 (1290546) | 1290546..1291307 | + | 762 | WP_015239693.1 | hypothetical protein | - |
QOS64_RS06695 (1291359) | 1291359..1291622 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
QOS64_RS06700 (1291636) | 1291636..1291899 | + | 264 | WP_003154813.1 | phage holin | - |
QOS64_RS06705 (1291913) | 1291913..1292791 | + | 879 | WP_043021264.1 | N-acetylmuramoyl-L-alanine amidase | - |
QOS64_RS06710 (1293048) | 1293048..1293218 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QOS64_RS06715 (1293219) | 1293219..1293965 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QOS64_RS06720 (1294070) | 1294070..1295068 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
QOS64_RS06725 (1295081) | 1295081..1295698 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
QOS64_RS06730 (1295984) | 1295984..1297300 | - | 1317 | WP_007610842.1 | amino acid permease | - |
QOS64_RS06735 (1297625) | 1297625..1298575 | + | 951 | WP_012117369.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T297041 WP_007407256.1 NZ_OX460973:c1293965-1293219 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|