Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 499824..500461 | Replicon | chromosome |
Accession | NZ_OX460973 | ||
Organism | Bacillus velezensis strain SAF3325 substr. 0 isolate SAF3325 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QOS64_RS02520 | Protein ID | WP_003156187.1 |
Coordinates | 500111..500461 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QOS64_RS02515 | Protein ID | WP_003156188.1 |
Coordinates | 499824..500105 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS64_RS02495 (496189) | 496189..496788 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
QOS64_RS02500 (496881) | 496881..497246 | + | 366 | WP_094031521.1 | holo-ACP synthase | - |
QOS64_RS02505 (497411) | 497411..498418 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QOS64_RS02510 (498535) | 498535..499704 | + | 1170 | WP_098081026.1 | alanine racemase | - |
QOS64_RS02515 (499824) | 499824..500105 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QOS64_RS02520 (500111) | 500111..500461 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QOS64_RS02525 (500579) | 500579..501400 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
QOS64_RS02530 (501405) | 501405..501770 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
QOS64_RS02535 (501773) | 501773..502174 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QOS64_RS02540 (502186) | 502186..503193 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
QOS64_RS02545 (503257) | 503257..503586 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QOS64_RS02550 (503583) | 503583..504065 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
QOS64_RS02555 (504031) | 504031..504819 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QOS64_RS02560 (504819) | 504819..505421 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T297040 WP_003156187.1 NZ_OX460973:500111-500461 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|