Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 251201..251813 Replicon chromosome
Accession NZ_OX460968
Organism Streptococcus agalactiae isolate MRI Z2-342

Toxin (Protein)


Gene name parE Uniprot ID Q8E7D3
Locus tag QOR54_RS01465 Protein ID WP_000384859.1
Coordinates 251201..251536 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q8E7D2
Locus tag QOR54_RS01470 Protein ID WP_000259017.1
Coordinates 251526..251813 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOR54_RS01440 246423..247556 - 1134 WP_000564846.1 ISAs1-like element IS1548 family transposase -
QOR54_RS01445 247652..248215 + 564 Protein_229 replication initiation factor domain-containing protein -
QOR54_RS01450 248251..248685 + 435 WP_001220479.1 hypothetical protein -
QOR54_RS01455 249002..250258 + 1257 WP_000122836.1 MobV family relaxase -
QOR54_RS01460 250426..250896 + 471 WP_000130119.1 hypothetical protein -
QOR54_RS01465 251201..251536 - 336 WP_000384859.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOR54_RS01470 251526..251813 - 288 WP_000259017.1 hypothetical protein Antitoxin
QOR54_RS01475 252320..252610 + 291 WP_000078283.1 WXG100 family type VII secretion target -
QOR54_RS01480 252712..253119 + 408 WP_000749954.1 hypothetical protein -
QOR54_RS01485 253119..253679 + 561 WP_001865562.1 hypothetical protein -
QOR54_RS01490 253652..254332 + 681 WP_001865565.1 hypothetical protein -
QOR54_RS01495 254317..254703 + 387 WP_000259069.1 hypothetical protein -
QOR54_RS01500 254737..255018 + 282 WP_000052406.1 hypothetical protein -
QOR54_RS01505 255861..256721 + 861 WP_000477654.1 Rgg/GadR/MutR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 241906..252087 10181
- flank IS/Tn - - 246423..247556 1133


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-106)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13296.98 Da        Isoelectric Point: 4.6565

>T297039 WP_000384859.1 NZ_OX460968:c251536-251201 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10906.50 Da        Isoelectric Point: 4.7271

>AT297039 WP_000259017.1 NZ_OX460968:c251813-251526 [Streptococcus agalactiae]
MVTVEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEISKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A076Z4V6

References