Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4613204..4613925 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QOT00_RS21340 | Protein ID | WP_047399350.1 |
Coordinates | 4613204..4613545 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0A0FFR4 |
Locus tag | QOT00_RS21345 | Protein ID | WP_045265421.1 |
Coordinates | 4613581..4613925 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS21320 | 4609795..4610832 | - | 1038 | WP_045265419.1 | virulence RhuM family protein | - |
QOT00_RS21325 | 4610920..4611240 | - | 321 | Protein_4151 | DUF4942 domain-containing protein | - |
QOT00_RS21335 | 4612571..4613089 | - | 519 | Protein_4153 | DUF4942 domain-containing protein | - |
QOT00_RS21340 | 4613204..4613545 | - | 342 | WP_047399350.1 | TA system toxin CbtA family protein | Toxin |
QOT00_RS21345 | 4613581..4613925 | - | 345 | WP_045265421.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QOT00_RS21350 | 4613949..4614170 | - | 222 | WP_047399352.1 | DUF987 family protein | - |
QOT00_RS21355 | 4614181..4614654 | - | 474 | WP_047399355.1 | DNA repair protein RadC | - |
QOT00_RS21360 | 4614725..4615546 | - | 822 | WP_283648209.1 | DUF932 domain-containing protein | - |
QOT00_RS21365 | 4615615..4616070 | - | 456 | WP_047399359.1 | hypothetical protein | - |
QOT00_RS21370 | 4616302..4617105 | - | 804 | WP_045265426.1 | hypothetical protein | - |
QOT00_RS21375 | 4617125..4617559 | - | 435 | WP_045265427.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12748.67 Da Isoelectric Point: 8.5196
>T297036 WP_047399350.1 NZ_OX460963:c4613545-4613204 [Hafnia paralvei]
MNTSPATNQRVAKPCPSPVAVWQMLLTRLLAQHYGLALSDTPFCDETVIQEHINAGVTLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQAMGLLRQGHNLSTR
MNTSPATNQRVAKPCPSPVAVWQMLLTRLLAQHYGLALSDTPFCDETVIQEHINAGVTLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQAMGLLRQGHNLSTR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|