Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4185683..4186363 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | QOT00_RS19445 | Protein ID | WP_283648133.1 |
Coordinates | 4185683..4186003 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QOT00_RS19450 | Protein ID | WP_283648134.1 |
Coordinates | 4186040..4186363 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS19430 | 4181164..4182297 | - | 1134 | WP_064572704.1 | pentaheme c-type cytochrome TorC | - |
QOT00_RS19435 | 4182488..4183963 | + | 1476 | WP_283648131.1 | PLP-dependent aminotransferase family protein | - |
QOT00_RS19440 | 4184733..4185569 | - | 837 | WP_283648132.1 | DUF4942 domain-containing protein | - |
QOT00_RS19445 | 4185683..4186003 | - | 321 | WP_283648133.1 | TA system toxin CbtA family protein | Toxin |
QOT00_RS19450 | 4186040..4186363 | - | 324 | WP_283648134.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QOT00_RS19455 | 4186376..4186846 | - | 471 | WP_283648135.1 | DNA repair protein RadC | - |
QOT00_RS19460 | 4186917..4187735 | - | 819 | WP_283648136.1 | DUF932 domain-containing protein | - |
QOT00_RS19465 | 4187885..4188682 | - | 798 | WP_283648137.1 | hypothetical protein | - |
QOT00_RS19470 | 4189126..4190010 | - | 885 | WP_283648138.1 | 50S ribosome-binding GTPase | - |
QOT00_RS19475 | 4190102..4190923 | - | 822 | WP_283648139.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12112.80 Da Isoelectric Point: 5.9559
>T297035 WP_283648133.1 NZ_OX460963:c4186003-4185683 [Hafnia paralvei]
MHTSTVPATVPVSSRLPPVQVWQQLLTYLLEHHYGLTLNDTPFHDDSAIQEHIEAGITLADAVNFLVERYELIRTDRKGF
TWQEQTPFLTAIDILRARRATGLMNI
MHTSTVPATVPVSSRLPPVQVWQQLLTYLLEHHYGLTLNDTPFHDDSAIQEHIEAGITLADAVNFLVERYELIRTDRKGF
TWQEQTPFLTAIDILRARRATGLMNI
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|