Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4118301..4118868 | Replicon | chromosome |
| Accession | NZ_OX460963 | ||
| Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QOT00_RS19165 | Protein ID | WP_105375245.1 |
| Coordinates | 4118301..4118435 (+) | Length | 45 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G9YED8 |
| Locus tag | QOT00_RS19170 | Protein ID | WP_004097419.1 |
| Coordinates | 4118458..4118868 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOT00_RS19145 | 4113469..4114575 | + | 1107 | WP_008815234.1 | transglutaminase domain-containing protein | - |
| QOT00_RS19150 | 4114626..4115144 | - | 519 | WP_283648121.1 | cytochrome b/b6 domain-containing protein | - |
| QOT00_RS19155 | 4115147..4115539 | - | 393 | WP_039184830.1 | cytochrome b562 | - |
| QOT00_RS19160 | 4116574..4117914 | - | 1341 | WP_008815237.1 | metalloprotease PmbA | - |
| QOT00_RS19165 | 4118301..4118435 | + | 135 | WP_105375245.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QOT00_RS19170 | 4118458..4118868 | + | 411 | WP_004097419.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QOT00_RS19175 | 4118973..4119530 | + | 558 | WP_039184825.1 | ribosome biogenesis factor YjgA | - |
| QOT00_RS19180 | 4119610..4119888 | - | 279 | WP_039184822.1 | barstar family protein | - |
| QOT00_RS19185 | 4119894..4120352 | - | 459 | WP_008815240.1 | ribonuclease domain-containing protein | - |
| QOT00_RS19190 | 4120612..4122102 | - | 1491 | WP_048797737.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| QOT00_RS19195 | 4122399..4123793 | - | 1395 | WP_193764060.1 | ATP-dependent RNA helicase DbpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4901.75 Da Isoelectric Point: 11.9239
>T297034 WP_105375245.1 NZ_OX460963:4118301-4118435 [Hafnia paralvei]
ILKRVKGSHHHFTHPNKTGLVTIPHPKKDLPANTVKSIRQQAGL
ILKRVKGSHHHFTHPNKTGLVTIPHPKKDLPANTVKSIRQQAGL
Download Length: 135 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14951.18 Da Isoelectric Point: 4.5106
>AT297034 WP_004097419.1 NZ_OX460963:4118458-4118868 [Hafnia paralvei]
MLYPIAIESGDQHHAYGVTVPDLPGCFSAGDTLDEAIANAKQAIISHIELLVEMEADFPMPSKIEDLSNKAEYQEYIWAI
VEVDVTRLMGGAEKINVTLPKSLIARIDRVVALHPEYKSRSGFLAQAALEQVTVIK
MLYPIAIESGDQHHAYGVTVPDLPGCFSAGDTLDEAIANAKQAIISHIELLVEMEADFPMPSKIEDLSNKAEYQEYIWAI
VEVDVTRLMGGAEKINVTLPKSLIARIDRVVALHPEYKSRSGFLAQAALEQVTVIK
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|