Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3480467..3481058 | Replicon | chromosome |
| Accession | NZ_OX460963 | ||
| Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | G9Y5B5 |
| Locus tag | QOT00_RS16250 | Protein ID | WP_004091739.1 |
| Coordinates | 3480855..3481058 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A4Q9EVH1 |
| Locus tag | QOT00_RS16245 | Protein ID | WP_008814252.1 |
| Coordinates | 3480467..3480841 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOT00_RS16230 | 3476225..3479377 | + | 3153 | WP_039188527.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QOT00_RS16235 | 3479538..3479810 | + | 273 | WP_004091742.1 | type B 50S ribosomal protein L31 | - |
| QOT00_RS16240 | 3479810..3479950 | + | 141 | WP_020303633.1 | type B 50S ribosomal protein L36 | - |
| QOT00_RS16245 | 3480467..3480841 | + | 375 | WP_008814252.1 | Hha toxicity modulator TomB | Antitoxin |
| QOT00_RS16250 | 3480855..3481058 | + | 204 | WP_004091739.1 | HHA domain-containing protein | Toxin |
| QOT00_RS16260 | 3482003..3482335 | + | 333 | WP_130954960.1 | MGMT family protein | - |
| QOT00_RS16265 | 3482393..3482911 | - | 519 | WP_008814254.1 | YbaY family lipoprotein | - |
| QOT00_RS16270 | 3483224..3484084 | + | 861 | WP_008814255.1 | acyl-CoA thioesterase II | - |
| QOT00_RS16275 | 3484148..3485437 | - | 1290 | WP_039188520.1 | ammonium transporter AmtB | - |
| QOT00_RS16280 | 3485471..3485809 | - | 339 | WP_004091732.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8119.38 Da Isoelectric Point: 5.8346
>T297033 WP_004091739.1 NZ_OX460963:3480855-3481058 [Hafnia paralvei]
MTKIDYLMRLRKCTTLDTLERVIEKNKYELSDDELETFYSAADHRLAELTMNKLYDKIPAEVWKYVR
MTKIDYLMRLRKCTTLDTLERVIEKNKYELSDDELETFYSAADHRLAELTMNKLYDKIPAEVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14447.17 Da Isoelectric Point: 4.4776
>AT297033 WP_008814252.1 NZ_OX460963:3480467-3480841 [Hafnia paralvei]
MDEYTSYQHDITELKYLCNMLYNQGMDVLSDSHHGWVNDPTAVDNLQLNELNEHIANFGLTFKIKYPNASELTEILDEYL
DETYSLFSNYSINEPELKKWLKAKGRILRYLAGEKTTSALNFNL
MDEYTSYQHDITELKYLCNMLYNQGMDVLSDSHHGWVNDPTAVDNLQLNELNEHIANFGLTFKIKYPNASELTEILDEYL
DETYSLFSNYSINEPELKKWLKAKGRILRYLAGEKTTSALNFNL
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G9Y5B5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Q9EVH1 |