Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 2477097..2477894 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | QOT00_RS11740 | Protein ID | WP_096080816.1 |
Coordinates | 2477370..2477894 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A2A2MFP5 |
Locus tag | QOT00_RS11735 | Protein ID | WP_039186676.1 |
Coordinates | 2477097..2477366 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS11720 | 2472690..2473721 | - | 1032 | WP_020303739.1 | Mal regulon transcriptional regulator MalI | - |
QOT00_RS11725 | 2474003..2475598 | + | 1596 | WP_039186680.1 | maltose/glucose-specific PTS transporter subunit IIBC | - |
QOT00_RS11730 | 2475686..2476861 | + | 1176 | WP_061060038.1 | MalY/PatB family protein | - |
QOT00_RS11735 | 2477097..2477366 | + | 270 | WP_039186676.1 | DUF1778 domain-containing protein | Antitoxin |
QOT00_RS11740 | 2477370..2477894 | + | 525 | WP_096080816.1 | GNAT family N-acetyltransferase | Toxin |
QOT00_RS11745 | 2478076..2479074 | + | 999 | WP_008813542.1 | adenosine deaminase | - |
QOT00_RS11750 | 2479683..2480681 | - | 999 | WP_008813543.1 | bile acid:sodium symporter family protein | - |
QOT00_RS11755 | 2480813..2481856 | - | 1044 | WP_283647840.1 | oxidoreductase | - |
QOT00_RS11760 | 2482105..2482281 | - | 177 | WP_283647841.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19687.55 Da Isoelectric Point: 7.0494
>T297028 WP_096080816.1 NZ_OX460963:2477370-2477894 [Hafnia paralvei]
MPDLAIEIFSNDIEYDFAHFDCGEESLNIFLTNHLARQHNSRILRGYLLVTKEPKPKIVGYYTLSGSCFEKETLPSNTQK
RKVPYANVPSVTLGRLAIQKELQGQDWGTTLVTHAMKVIYHASLAVGIHGMFVDALNEKAKRFYLQLGFIALTGNNANSL
FYPTKSIEKLFEDE
MPDLAIEIFSNDIEYDFAHFDCGEESLNIFLTNHLARQHNSRILRGYLLVTKEPKPKIVGYYTLSGSCFEKETLPSNTQK
RKVPYANVPSVTLGRLAIQKELQGQDWGTTLVTHAMKVIYHASLAVGIHGMFVDALNEKAKRFYLQLGFIALTGNNANSL
FYPTKSIEKLFEDE
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|