Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 921711..922372 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | S3IMJ6 |
Locus tag | QOT00_RS04370 | Protein ID | WP_000698542.1 |
Coordinates | 922049..922372 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | S3J179 |
Locus tag | QOT00_RS04365 | Protein ID | WP_000065326.1 |
Coordinates | 921711..922028 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS04320 | 916851..917675 | + | 825 | WP_000197385.1 | DUF932 domain-containing protein | - |
QOT00_RS04325 | 917884..918594 | + | 711 | WP_024198336.1 | hypothetical protein | - |
QOT00_RS04330 | 918620..919156 | + | 537 | WP_000219797.1 | DUF4339 domain-containing protein | - |
QOT00_RS04335 | 919198..919635 | + | 438 | WP_024198335.1 | hypothetical protein | - |
QOT00_RS04340 | 919702..920112 | + | 411 | WP_000912997.1 | hypothetical protein | - |
QOT00_RS04345 | 920190..920426 | + | 237 | WP_000004273.1 | DUF905 domain-containing protein | - |
QOT00_RS04350 | 920512..920970 | + | 459 | WP_016538084.1 | antirestriction protein | - |
QOT00_RS04355 | 920986..921462 | + | 477 | WP_000811694.1 | RadC family protein | - |
QOT00_RS04360 | 921471..921692 | + | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
QOT00_RS04365 | 921711..922028 | + | 318 | WP_000065326.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QOT00_RS04370 | 922049..922372 | + | 324 | WP_000698542.1 | TA system toxin CbtA family protein | Toxin |
QOT00_RS04375 | 923062..923766 | - | 705 | WP_008815084.1 | CZB domain-containing protein | - |
QOT00_RS04380 | 924174..925244 | - | 1071 | WP_020303490.1 | hypothetical protein | - |
QOT00_RS04385 | 925285..925812 | - | 528 | WP_283647558.1 | fimbrial protein | - |
QOT00_RS04390 | 925799..926500 | - | 702 | WP_095661578.1 | fimbrial chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 903344..931551 | 28207 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.38 Da Isoelectric Point: 8.9789
>T297027 WP_000698542.1 NZ_OX460963:922049-922372 [Hafnia paralvei]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|