Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 878856..879516 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2A2MBB6 |
Locus tag | QOT00_RS04125 | Protein ID | WP_008815043.1 |
Coordinates | 879103..879516 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A2A2MBZ0 |
Locus tag | QOT00_RS04120 | Protein ID | WP_008815042.1 |
Coordinates | 878856..879122 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS04105 | 875035..875919 | + | 885 | WP_004846922.1 | nucleoside-specific channel-forming protein Tsx | - |
QOT00_RS04110 | 876123..876947 | + | 825 | WP_283647553.1 | shikimate 5-dehydrogenase | - |
QOT00_RS04115 | 877495..878481 | - | 987 | WP_283647554.1 | tRNA-modifying protein YgfZ | - |
QOT00_RS04120 | 878856..879122 | + | 267 | WP_008815042.1 | FAD assembly factor SdhE | Antitoxin |
QOT00_RS04125 | 879103..879516 | + | 414 | WP_008815043.1 | protein YgfX | Toxin |
QOT00_RS04130 | 879565..880083 | - | 519 | WP_283647555.1 | flavodoxin FldB | - |
QOT00_RS04135 | 880287..881186 | + | 900 | WP_061059194.1 | site-specific tyrosine recombinase XerD | - |
QOT00_RS04140 | 881215..881931 | + | 717 | WP_061059193.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QOT00_RS04145 | 881937..883670 | + | 1734 | WP_283647556.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16260.00 Da Isoelectric Point: 9.1742
>T297026 WP_008815043.1 NZ_OX460963:879103-879516 [Hafnia paralvei]
VDQWRCDVRVSWRTQLLLLVTHGTLVLLILLAPWPENYSIYWLILLTLVVFESIRSQKQIAKVQGELNFLAENRISWQHQ
EWELCKTPWISDFGALLPLKSLKDQDKRKRLWIAADSLTPEAWSHLRRSLMQMRHDA
VDQWRCDVRVSWRTQLLLLVTHGTLVLLILLAPWPENYSIYWLILLTLVVFESIRSQKQIAKVQGELNFLAENRISWQHQ
EWELCKTPWISDFGALLPLKSLKDQDKRKRLWIAADSLTPEAWSHLRRSLMQMRHDA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2MBB6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2MBZ0 |