Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 743288..743970 | Replicon | chromosome |
Accession | NZ_OX460963 | ||
Organism | Hafnia paralvei strain MIP2461 isolate MIP2461 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QOT00_RS03505 | Protein ID | WP_283647537.1 |
Coordinates | 743629..743970 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QOT00_RS03500 | Protein ID | WP_283647536.1 |
Coordinates | 743288..743608 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT00_RS03460 | 738846..739685 | + | 840 | WP_283647530.1 | DUF932 domain-containing protein | - |
QOT00_RS03465 | 739887..740591 | + | 705 | WP_283647531.1 | WYL domain-containing protein | - |
QOT00_RS03470 | 740588..741202 | + | 615 | WP_283647532.1 | hypothetical protein | - |
QOT00_RS03475 | 741292..741702 | + | 411 | WP_283647533.1 | hypothetical protein | - |
QOT00_RS03480 | 741779..741994 | + | 216 | Protein_662 | DUF905 domain-containing protein | - |
QOT00_RS03485 | 742090..742548 | + | 459 | WP_283647534.1 | antirestriction protein | - |
QOT00_RS03490 | 742557..743039 | + | 483 | WP_283647535.1 | DNA repair protein RadC | - |
QOT00_RS03495 | 743048..743269 | + | 222 | WP_023233115.1 | DUF987 domain-containing protein | - |
QOT00_RS03500 | 743288..743608 | + | 321 | WP_283647536.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QOT00_RS03505 | 743629..743970 | + | 342 | WP_283647537.1 | TA system toxin CbtA family protein | Toxin |
QOT00_RS03510 | 744383..744895 | + | 513 | WP_283647538.1 | hypothetical protein | - |
QOT00_RS03515 | 745210..745413 | + | 204 | Protein_669 | DUF4942 domain-containing protein | - |
QOT00_RS03525 | 745719..746213 | + | 495 | WP_008814957.1 | G/U mismatch-specific DNA glycosylase | - |
QOT00_RS03530 | 746281..748113 | - | 1833 | WP_004846659.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 729307..744895 | 15588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12913.87 Da Isoelectric Point: 9.0116
>T297025 WP_283647537.1 NZ_OX460963:743629-743970 [Hafnia paralvei]
MKTLPATISRATKPCLSHVAVWQMLLTRLLEQHYGLTLNNTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRRSHNNAVL
MKTLPATISRATKPCLSHVAVWQMLLTRLLEQHYGLTLNNTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRRSHNNAVL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|