Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3267041..3267666 | Replicon | chromosome |
Accession | NZ_OX460951 | ||
Organism | Morganella morganii strain HIS2824 isolate HIS2824 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A0A2RCL2 |
Locus tag | QOS63_RS15590 | Protein ID | WP_024474604.1 |
Coordinates | 3267463..3267666 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QOS63_RS15585 | Protein ID | WP_046893178.1 |
Coordinates | 3267041..3267400 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS63_RS15575 | 3262095..3263288 | + | 1194 | WP_046893180.1 | efflux RND transporter periplasmic adaptor subunit | - |
QOS63_RS15580 | 3263303..3266479 | + | 3177 | WP_046893179.1 | efflux RND transporter permease subunit | - |
QOS63_RS15585 | 3267041..3267400 | + | 360 | WP_046893178.1 | Hha toxicity modulator TomB | Antitoxin |
QOS63_RS15590 | 3267463..3267666 | + | 204 | WP_024474604.1 | HHA domain-containing protein | Toxin |
QOS63_RS15600 | 3268555..3269418 | + | 864 | WP_046893176.1 | acyl-CoA thioesterase II | - |
QOS63_RS15605 | 3269479..3270768 | - | 1290 | WP_052926736.1 | ammonium transporter AmtB | - |
QOS63_RS15610 | 3270788..3271126 | - | 339 | WP_046893175.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8073.39 Da Isoelectric Point: 6.9770
>T297022 WP_024474604.1 NZ_OX460951:3267463-3267666 [Morganella morganii]
MTKLDYLMRLRKCTSIETLERVIEKNKYELTDDELEVFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKLDYLMRLRKCTSIETLERVIEKNKYELTDDELEVFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13840.57 Da Isoelectric Point: 4.2870
>AT297022 WP_046893178.1 NZ_OX460951:3267041-3267400 [Morganella morganii]
MDEYSPRNYDIAVLKYLCDELCREGTQTLIRSNNFWVNDLASDSNLKLNELLGYIADVTWSFKIKHTQNKDLISFVDEYI
DETYALFGQMEVSFNDVEEWKKMASLVSSMLTSEGHLVH
MDEYSPRNYDIAVLKYLCDELCREGTQTLIRSNNFWVNDLASDSNLKLNELLGYIADVTWSFKIKHTQNKDLISFVDEYI
DETYALFGQMEVSFNDVEEWKKMASLVSSMLTSEGHLVH
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|