Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 239726..240338 Replicon chromosome
Accession NZ_OX460941
Organism Streptococcus agalactiae isolate MRI Z2-304

Toxin (Protein)


Gene name parE Uniprot ID Q8E7D3
Locus tag QOR58_RS01410 Protein ID WP_000384859.1
Coordinates 239726..240061 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q8E7D2
Locus tag QOR58_RS01415 Protein ID WP_000259017.1
Coordinates 240051..240338 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOR58_RS01380 234886..235167 + 282 WP_000134668.1 helix-turn-helix domain-containing protein -
QOR58_RS01385 235173..235499 + 327 WP_000384273.1 replication initiator protein A -
QOR58_RS01390 235503..236144 + 642 WP_000591146.1 hypothetical protein -
QOR58_RS01395 236444..237289 + 846 WP_154704804.1 replication initiation protein -
QOR58_RS01400 237601..238905 + 1305 WP_000122840.1 MobV family relaxase -
QOR58_RS01405 239071..239541 + 471 WP_000185727.1 hypothetical protein -
QOR58_RS01410 239726..240061 - 336 WP_000384859.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOR58_RS01415 240051..240338 - 288 WP_000259017.1 hypothetical protein Antitoxin
QOR58_RS01420 240844..241134 + 291 WP_000078283.1 WXG100 family type VII secretion target -
QOR58_RS01425 241236..241643 + 408 WP_000749954.1 hypothetical protein -
QOR58_RS01430 241855..242028 + 174 WP_228322106.1 hypothetical protein -
QOR58_RS01435 242175..242855 + 681 WP_001883493.1 hypothetical protein -
QOR58_RS01440 242840..243226 + 387 WP_000259067.1 hypothetical protein -
QOR58_RS01445 243260..243541 + 282 WP_000094847.1 hypothetical protein -
QOR58_RS01450 243732..244907 - 1176 WP_000191687.1 IS256-like element ISSag11 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 243732..244907 1175


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-106)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13296.98 Da        Isoelectric Point: 4.6565

>T297013 WP_000384859.1 NZ_OX460941:c240061-239726 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10906.50 Da        Isoelectric Point: 4.7271

>AT297013 WP_000259017.1 NZ_OX460941:c240338-240051 [Streptococcus agalactiae]
MVTVEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEISKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A076Z4V6

References