Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 2066240..2066864 Replicon chromosome
Accession NZ_OX460940
Organism Streptococcus agalactiae isolate MRI Z2-179

Toxin (Protein)


Gene name parE Uniprot ID A0A076ZDW1
Locus tag QOR62_RS10450 Protein ID WP_000253103.1
Coordinates 2066240..2066587 (-) Length 116 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A076YVN5
Locus tag QOR62_RS10455 Protein ID WP_000543070.1
Coordinates 2066577..2066864 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOR62_RS10430 2061955..2062311 - 357 WP_000105934.1 DUF1304 domain-containing protein -
QOR62_RS10435 2062378..2064696 - 2319 WP_000883414.1 YhgE/Pip domain-containing protein -
QOR62_RS10440 2064835..2065374 + 540 WP_000245858.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
QOR62_RS10445 2065460..2065756 - 297 WP_001052249.1 DUF4298 domain-containing protein -
QOR62_RS10450 2066240..2066587 - 348 WP_000253103.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOR62_RS10455 2066577..2066864 - 288 WP_000543070.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QOR62_RS10460 2066933..2067310 - 378 WP_000038826.1 ArpU family phage packaging/lysis transcriptional regulator -
QOR62_RS10465 2067285..2067437 - 153 Protein_1991 DUF1492 domain-containing protein -
QOR62_RS10470 2067444..2067932 - 489 WP_000891151.1 hypothetical protein -
QOR62_RS10475 2068005..2068562 - 558 WP_001258765.1 hypothetical protein -
QOR62_RS10480 2068720..2068893 - 174 WP_000694573.1 hypothetical protein -
QOR62_RS10485 2068890..2069147 - 258 WP_001069293.1 hypothetical protein -
QOR62_RS10490 2069440..2070834 - 1395 WP_000656430.1 VapE family protein -
QOR62_RS10495 2070846..2071703 - 858 WP_001029296.1 primase alpha helix C-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2061078..2103090 42012


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(12-108)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-63)


Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 13333.09 Da        Isoelectric Point: 5.1643

>T297012 WP_000253103.1 NZ_OX460940:c2066587-2066240 [Streptococcus agalactiae]
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSDIIHSKQDYIKLFKKK

Download         Length: 348 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10605.98 Da        Isoelectric Point: 4.8430

>AT297012 WP_000543070.1 NZ_OX460940:c2066864-2066577 [Streptococcus agalactiae]
MHALEKNTQVNFKTNSDLLEKAKAIIAAQNLDMTASFNLFLENIVQNKALPFETDTDKERAELLAGLRAEIAKSFDDLEH
GRVYNASEVRANLGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A076ZDW1

Antitoxin

Source ID Structure
AlphaFold DB A0A076YVN5

References