Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 2110581..2111205 | Replicon | chromosome |
Accession | NZ_OX460938 | ||
Organism | Streptococcus agalactiae isolate MRI Z2-318 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A076ZDW1 |
Locus tag | QOR49_RS10650 | Protein ID | WP_000253103.1 |
Coordinates | 2110581..2110928 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A076YVN5 |
Locus tag | QOR49_RS10655 | Protein ID | WP_000543070.1 |
Coordinates | 2110918..2111205 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOR49_RS10630 | 2106296..2106652 | - | 357 | WP_000105934.1 | DUF1304 domain-containing protein | - |
QOR49_RS10635 | 2106719..2109037 | - | 2319 | WP_283572725.1 | YhgE/Pip domain-containing protein | - |
QOR49_RS10640 | 2109176..2109715 | + | 540 | WP_000245858.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
QOR49_RS10645 | 2109801..2110097 | - | 297 | WP_001052249.1 | DUF4298 domain-containing protein | - |
QOR49_RS10650 | 2110581..2110928 | - | 348 | WP_000253103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOR49_RS10655 | 2110918..2111205 | - | 288 | WP_000543070.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QOR49_RS10660 | 2111274..2111651 | - | 378 | WP_000038826.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
QOR49_RS10665 | 2111626..2111778 | - | 153 | Protein_2031 | DUF1492 domain-containing protein | - |
QOR49_RS10670 | 2111785..2112273 | - | 489 | WP_000891151.1 | hypothetical protein | - |
QOR49_RS10675 | 2112346..2112903 | - | 558 | WP_001258765.1 | hypothetical protein | - |
QOR49_RS10680 | 2113061..2113234 | - | 174 | WP_000694573.1 | hypothetical protein | - |
QOR49_RS10685 | 2113231..2113488 | - | 258 | WP_001069293.1 | hypothetical protein | - |
QOR49_RS10690 | 2113781..2115175 | - | 1395 | WP_000656430.1 | VapE family protein | - |
QOR49_RS10695 | 2115187..2116044 | - | 858 | WP_001029296.1 | primase alpha helix C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2105419..2124379 | 18960 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13333.09 Da Isoelectric Point: 5.1643
>T297009 WP_000253103.1 NZ_OX460938:c2110928-2110581 [Streptococcus agalactiae]
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSDIIHSKQDYIKLFKKK
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSDIIHSKQDYIKLFKKK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A076ZDW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A076YVN5 |