Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 238894..239506 | Replicon | chromosome |
Accession | NZ_OX460938 | ||
Organism | Streptococcus agalactiae isolate MRI Z2-318 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q8E1X3 |
Locus tag | QOR49_RS01410 | Protein ID | WP_000384858.1 |
Coordinates | 238894..239229 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q8E1X2 |
Locus tag | QOR49_RS01415 | Protein ID | WP_000255538.1 |
Coordinates | 239219..239506 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOR49_RS01385 | 234092..234721 | + | 630 | WP_283572703.1 | hypothetical protein | - |
QOR49_RS01390 | 235034..235909 | + | 876 | WP_000770113.1 | hypothetical protein | - |
QOR49_RS01395 | 235945..236379 | + | 435 | WP_001220479.1 | hypothetical protein | - |
QOR49_RS01400 | 236695..237951 | + | 1257 | WP_000122832.1 | MobV family relaxase | - |
QOR49_RS01405 | 238119..238589 | + | 471 | WP_000130119.1 | hypothetical protein | - |
QOR49_RS01410 | 238894..239229 | - | 336 | WP_000384858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOR49_RS01415 | 239219..239506 | - | 288 | WP_000255538.1 | hypothetical protein | Antitoxin |
QOR49_RS01420 | 239909..241129 | - | 1221 | WP_000156558.1 | site-specific integrase | - |
QOR49_RS01425 | 241190..241450 | - | 261 | WP_001196072.1 | helix-turn-helix domain-containing protein | - |
QOR49_RS01430 | 241462..242208 | - | 747 | WP_000966632.1 | hypothetical protein | - |
QOR49_RS01435 | 242394..243185 | - | 792 | WP_001868842.1 | hypothetical protein | - |
QOR49_RS01440 | 243166..243699 | - | 534 | WP_000680721.1 | hypothetical protein | - |
QOR49_RS01445 | 243699..244037 | - | 339 | WP_001187920.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 190676..241234 | 50558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13264.04 Da Isoelectric Point: 5.2388
>T297008 WP_000384858.1 NZ_OX460938:c239229-238894 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1EF10 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1EFF9 |