Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 2123185..2123809 | Replicon | chromosome |
Accession | NZ_OX460934 | ||
Organism | Streptococcus agalactiae isolate MRI Z2-335 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QOR46_RS10700 | Protein ID | WP_000253104.1 |
Coordinates | 2123185..2123532 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A076YVN5 |
Locus tag | QOR46_RS10705 | Protein ID | WP_000543070.1 |
Coordinates | 2123522..2123809 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOR46_RS10680 | 2118901..2119257 | - | 357 | WP_000105933.1 | DUF1304 domain-containing protein | - |
QOR46_RS10685 | 2119324..2121642 | - | 2319 | WP_000883422.1 | YhgE/Pip domain-containing protein | - |
QOR46_RS10690 | 2121781..2122320 | + | 540 | WP_000245863.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
QOR46_RS10695 | 2122406..2122702 | - | 297 | WP_000365227.1 | DUF4298 domain-containing protein | - |
QOR46_RS10700 | 2123185..2123532 | - | 348 | WP_000253104.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOR46_RS10705 | 2123522..2123809 | - | 288 | WP_000543070.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QOR46_RS10710 | 2123878..2124255 | - | 378 | WP_000038826.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
QOR46_RS10715 | 2124230..2124382 | - | 153 | Protein_2040 | DUF1492 domain-containing protein | - |
QOR46_RS10720 | 2124389..2124877 | - | 489 | WP_000891152.1 | hypothetical protein | - |
QOR46_RS10725 | 2124950..2125507 | - | 558 | WP_001258771.1 | hypothetical protein | - |
QOR46_RS10730 | 2125509..2125682 | - | 174 | WP_000768928.1 | hypothetical protein | - |
QOR46_RS10735 | 2125688..2125861 | - | 174 | WP_000694578.1 | hypothetical protein | - |
QOR46_RS10740 | 2126195..2127697 | - | 1503 | WP_000838185.1 | DNA primase family protein | - |
QOR46_RS10745 | 2127717..2128574 | - | 858 | WP_001029300.1 | primase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2118024..2152071 | 34047 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13381.18 Da Isoelectric Point: 5.5857
>T297006 WP_000253104.1 NZ_OX460934:c2123532-2123185 [Streptococcus agalactiae]
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSYIIHSKQDYIKLFKKK
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSYIIHSKQDYIKLFKKK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|