Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1957142..1957766 Replicon chromosome
Accession NZ_OX460931
Organism Streptococcus agalactiae isolate MRI Z2-174

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QOR44_RS09895 Protein ID WP_000253104.1
Coordinates 1957142..1957489 (-) Length 116 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A076YVN5
Locus tag QOR44_RS09900 Protein ID WP_000543070.1
Coordinates 1957479..1957766 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOR44_RS09875 1952858..1953214 - 357 WP_000105933.1 DUF1304 domain-containing protein -
QOR44_RS09880 1953281..1955599 - 2319 WP_000883422.1 YhgE/Pip domain-containing protein -
QOR44_RS09885 1955738..1956277 + 540 WP_000245863.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
QOR44_RS09890 1956363..1956659 - 297 WP_000365227.1 DUF4298 domain-containing protein -
QOR44_RS09895 1957142..1957489 - 348 WP_000253104.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QOR44_RS09900 1957479..1957766 - 288 WP_000543070.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QOR44_RS09905 1957835..1958212 - 378 WP_000038826.1 ArpU family phage packaging/lysis transcriptional regulator -
QOR44_RS09910 1958187..1958339 - 153 Protein_1880 DUF1492 domain-containing protein -
QOR44_RS09915 1958346..1958834 - 489 WP_000891152.1 hypothetical protein -
QOR44_RS09920 1958907..1959464 - 558 WP_001258771.1 hypothetical protein -
QOR44_RS09925 1959466..1959639 - 174 WP_000768928.1 hypothetical protein -
QOR44_RS09930 1959645..1959818 - 174 WP_000694578.1 hypothetical protein -
QOR44_RS09935 1959933..1961435 - 1503 WP_000838185.1 DNA primase family protein -
QOR44_RS09940 1961455..1962312 - 858 WP_001029300.1 primase C-terminal domain-containing protein -
QOR44_RS09945 1962313..1962585 - 273 WP_000492120.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1951981..1993859 41878


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(12-108)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-63)


Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 13381.18 Da        Isoelectric Point: 5.5857

>T297001 WP_000253104.1 NZ_OX460931:c1957489-1957142 [Streptococcus agalactiae]
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSYIIHSKQDYIKLFKKK

Download         Length: 348 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10605.98 Da        Isoelectric Point: 4.8430

>AT297001 WP_000543070.1 NZ_OX460931:c1957766-1957479 [Streptococcus agalactiae]
MHALEKNTQVNFKTNSDLLEKAKAIIAAQNLDMTASFNLFLENIVQNKALPFETDTDKERAELLAGLRAEIAKSFDDLEH
GRVYNASEVRANLGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A076YVN5

References