Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 1031789..1032297 | Replicon | chromosome |
Accession | NZ_OX460910 | ||
Organism | Photobacterium phosphoreum strain MIP2473 isolate MIP2473 |
Toxin (Protein)
Gene name | relB | Uniprot ID | A0A2T3PYA4 |
Locus tag | QOS47_RS19335 | Protein ID | WP_045032845.1 |
Coordinates | 1031789..1032049 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A2T3PSM4 |
Locus tag | QOS47_RS19340 | Protein ID | WP_045032846.1 |
Coordinates | 1032046..1032297 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS47_RS19310 | 1027196..1027576 | + | 381 | WP_107293623.1 | hypothetical protein | - |
QOS47_RS19315 | 1027610..1028026 | - | 417 | WP_065193249.1 | GFA family protein | - |
QOS47_RS19320 | 1028167..1029039 | - | 873 | WP_065207857.1 | class I SAM-dependent methyltransferase | - |
QOS47_RS19325 | 1029299..1029589 | - | 291 | WP_045032289.1 | hypothetical protein | - |
QOS47_RS19330 | 1029946..1030827 | - | 882 | WP_283598836.1 | NAD(P)-dependent oxidoreductase | - |
QOS47_RS19335 | 1031789..1032049 | - | 261 | WP_045032845.1 | Txe/YoeB family addiction module toxin | Toxin |
QOS47_RS19340 | 1032046..1032297 | - | 252 | WP_045032846.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QOS47_RS19345 | 1033136..1033660 | - | 525 | WP_045032847.1 | DUF2442 domain-containing protein | - |
QOS47_RS19350 | 1033654..1033925 | - | 272 | Protein_848 | DUF4160 domain-containing protein | - |
QOS47_RS19355 | 1034512..1035036 | + | 525 | WP_283599192.1 | tyrosine-type recombinase/integrase | - |
QOS47_RS19360 | 1035033..1036091 | + | 1059 | WP_283598840.1 | IS91 family transposase | - |
QOS47_RS19365 | 1036312..1036950 | - | 639 | WP_283598843.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10279.70 Da Isoelectric Point: 8.8610
>T296997 WP_045032845.1 NZ_OX460910:c1032049-1031789 [Photobacterium phosphoreum]
MSRMLAWTDDAWDDYLYWQGQDKKTLKRINKLITDTKRSPFEGIGKPEPLKENLAGFWSRRIDDTNRLVYVVNDAHLTII
SCRYHY
MSRMLAWTDDAWDDYLYWQGQDKKTLKRINKLITDTKRSPFEGIGKPEPLKENLAGFWSRRIDDTNRLVYVVNDAHLTII
SCRYHY
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T3PYA4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T3PSM4 |