Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1817537..1818059 | Replicon | chromosome |
Accession | NZ_OX460909 | ||
Organism | Photobacterium phosphoreum strain MIP2473 isolate MIP2473 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QOS47_RS08580 | Protein ID | WP_232611433.1 |
Coordinates | 1817775..1818059 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B5EU68 |
Locus tag | QOS47_RS08575 | Protein ID | WP_012535627.1 |
Coordinates | 1817537..1817785 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS47_RS08535 | 1812618..1812887 | + | 270 | Protein_1574 | phage integrase N-terminal SAM-like domain-containing protein | - |
QOS47_RS08540 | 1812971..1813243 | + | 273 | WP_065209072.1 | DUF1778 domain-containing protein | - |
QOS47_RS08545 | 1813240..1813746 | + | 507 | WP_279143375.1 | GNAT family N-acetyltransferase | - |
QOS47_RS08550 | 1813925..1814200 | + | 276 | Protein_1577 | site-specific integrase | - |
QOS47_RS08555 | 1814793..1815878 | + | 1086 | WP_283597469.1 | hypothetical protein | - |
QOS47_RS08560 | 1816075..1816347 | + | 273 | Protein_1579 | site-specific integrase | - |
QOS47_RS08565 | 1816801..1817046 | - | 246 | WP_105063926.1 | CopG family transcriptional regulator | - |
QOS47_RS08570 | 1817090..1817299 | - | 210 | WP_107293800.1 | BrnT family toxin | - |
QOS47_RS08575 | 1817537..1817785 | + | 249 | WP_012535627.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QOS47_RS08580 | 1817775..1818059 | + | 285 | WP_232611433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOS47_RS08585 | 1818210..1818527 | + | 318 | WP_283598093.1 | phage integrase N-terminal SAM-like domain-containing protein | - |
QOS47_RS08590 | 1818485..1818787 | + | 303 | Protein_1585 | transposase | - |
QOS47_RS08595 | 1819016..1819468 | - | 453 | WP_283597470.1 | hypothetical protein | - |
QOS47_RS08600 | 1819731..1820621 | + | 891 | Protein_1587 | site-specific integrase | - |
QOS47_RS08605 | 1820618..1821676 | + | 1059 | WP_283597471.1 | IS91 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1810010..1824163 | 14153 | |
- | inside | IScluster/Tn | - | - | 1813922..1820621 | 6699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11014.93 Da Isoelectric Point: 10.4661
>T296995 WP_232611433.1 NZ_OX460909:1817775-1818059 [Photobacterium phosphoreum]
MTYKLDFKKSAYKEWNKLGATLREQFKKKLLERLDNPHVPASKLSGADNLYKIKLQQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYKKAMHRI
MTYKLDFKKSAYKEWNKLGATLREQFKKKLLERLDNPHVPASKLSGADNLYKIKLQQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYKKAMHRI
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|