Detailed information of TA system TA296994

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /BrnT(toxin)
• Location: 1816801..1817299
• Replicon: chromosome
• Accession: NZ_OX460909
• Organism: Photobacterium phosphoreum strain MIP2473 isolate MIP2473

Toxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: QOS47_RS08570
• Protein ID: WP_107293800.1
• Coordinates: 1817090..1817299 (-)
• Length: 70 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: QOS47_RS08565
• Protein ID: WP_105063926.1
• Coordinates: 1816801..1817046 (-)
• Length: 82 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QOS47_RS08530	1811924..1812505	-	582	WP_283597468.1	HD domain-containing protein	-
QOS47_RS08535	1812618..1812887	+	270	Protein_1574	phage integrase N-terminal SAM-like domain-containing protein	-
QOS47_RS08540	1812971..1813243	+	273	WP_065209072.1	DUF1778 domain-containing protein	-
QOS47_RS08545	1813240..1813746	+	507	WP_279143375.1	GNAT family N-acetyltransferase	-
QOS47_RS08550	1813925..1814200	+	276	Protein_1577	site-specific integrase	-
QOS47_RS08555	1814793..1815878	+	1086	WP_283597469.1	hypothetical protein	-
QOS47_RS08560	1816075..1816347	+	273	Protein_1579	site-specific integrase	-
QOS47_RS08565	1816801..1817046	-	246	WP_105063926.1	CopG family transcriptional regulator	Antitoxin
QOS47_RS08570	1817090..1817299	-	210	WP_107293800.1	BrnT family toxin	Toxin
QOS47_RS08575	1817537..1817785	+	249	WP_012535627.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
QOS47_RS08580	1817775..1818059	+	285	WP_232611433.1	type II toxin-antitoxin system RelE/ParE family toxin	-
QOS47_RS08585	1818210..1818527	+	318	WP_283598093.1	phage integrase N-terminal SAM-like domain-containing protein	-
QOS47_RS08590	1818485..1818787	+	303	Protein_1585	transposase	-
QOS47_RS08595	1819016..1819468	-	453	WP_283597470.1	hypothetical protein	-
QOS47_RS08600	1819731..1820621	+	891	Protein_1587	site-specific integrase	-
QOS47_RS08605	1820618..1821676	+	1059	WP_283597471.1	IS91 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	1810010..1824163	14153
	-	inside	IScluster/Tn	-	-	1813922..1820621	6699

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (6-69)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 70 a.a.
• Molecular weight: 7997.01 Da
• Isoelectric Point: 4.6217

>T296994 WP_107293800.1 NZ_OX460909:c1817299-1817090 [Photobacterium phosphoreum]
MVNFEFDEVKSNSNLEKHGVDFNVAQLLWNDPDLIEIPVNTHDEPRYIVIAMLNGKHWTGVITYRGQNI

Nucleotide

• Length: 210 bp

Antitoxin

Protein

• Length: 82 a.a.
• Molecular weight: 9184.35 Da
• Isoelectric Point: 5.6845

>AT296994 WP_105063926.1 NZ_OX460909:c1817046-1816801 [Photobacterium phosphoreum]
MKANEFDAKFDDGDDILGDLDLSKAKRPMQSQKRVNVDFPTWMIESLDREANRVGVTRQSIIKVWLAERLESVAANHAAS
H

Nucleotide

• Length: 246 bp