Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 1812971..1813746 Replicon chromosome
Accession NZ_OX460909
Organism Photobacterium phosphoreum strain MIP2473 isolate MIP2473

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag QOS47_RS08545 Protein ID WP_279143375.1
Coordinates 1813240..1813746 (+) Length 169 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag QOS47_RS08540 Protein ID WP_065209072.1
Coordinates 1812971..1813243 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOS47_RS08500 1808089..1808403 - 315 WP_045028698.1 hypothetical protein -
QOS47_RS08505 1808819..1809130 + 312 WP_065195290.1 NIPSNAP family protein -
QOS47_RS08510 1809248..1809451 + 204 Protein_1569 phage integrase N-terminal SAM-like domain-containing protein -
QOS47_RS08515 1810010..1810357 - 348 WP_045028701.1 DUF3024 domain-containing protein -
QOS47_RS08520 1810480..1811325 - 846 WP_107293668.1 MBL fold metallo-hydrolase -
QOS47_RS08525 1811475..1811771 - 297 WP_065195292.1 hypothetical protein -
QOS47_RS08530 1811924..1812505 - 582 WP_283597468.1 HD domain-containing protein -
QOS47_RS08535 1812618..1812887 + 270 Protein_1574 phage integrase N-terminal SAM-like domain-containing protein -
QOS47_RS08540 1812971..1813243 + 273 WP_065209072.1 DUF1778 domain-containing protein Antitoxin
QOS47_RS08545 1813240..1813746 + 507 WP_279143375.1 GNAT family N-acetyltransferase Toxin
QOS47_RS08550 1813925..1814200 + 276 Protein_1577 site-specific integrase -
QOS47_RS08555 1814793..1815878 + 1086 WP_283597469.1 hypothetical protein -
QOS47_RS08560 1816075..1816347 + 273 Protein_1579 site-specific integrase -
QOS47_RS08565 1816801..1817046 - 246 WP_105063926.1 CopG family transcriptional regulator -
QOS47_RS08570 1817090..1817299 - 210 WP_107293800.1 BrnT family toxin -
QOS47_RS08575 1817537..1817785 + 249 WP_012535627.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QOS47_RS08580 1817775..1818059 + 285 WP_232611433.1 type II toxin-antitoxin system RelE/ParE family toxin -
QOS47_RS08585 1818210..1818527 + 318 WP_283598093.1 phage integrase N-terminal SAM-like domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1810010..1824163 14153
- inside IScluster/Tn - - 1813922..1820621 6699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(84-149)

Antitoxin

Vibrio phage ICP1, Orf50

(7-85)


Sequences

Toxin        


Download         Length: 169 a.a.        Molecular weight: 19009.84 Da        Isoelectric Point: 7.4163

>T296993 WP_279143375.1 NZ_OX460909:1813240-1813746 [Photobacterium phosphoreum]
IMNTVQSEKAKHDRNRFDCGITALNNYLKVMASQQAKKDNTRTFVLEDKQYPEHIIGYYTLTMTPIDIQDLPPKLQKKHH
SVTSGGLIARLAVDHRYKGQGFGEWLLIDALRKLLMASETVAFPVVIVDAKDGAEDFYEKYGFTAFKDADNKLFITIADI
RASIGELI

Download         Length: 507 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9823.37 Da        Isoelectric Point: 9.8652

>AT296993 WP_065209072.1 NZ_OX460909:1812971-1813243 [Photobacterium phosphoreum]
MATALPRITARVDIDTQELLSQAAAIAGMSSINSFVLSAAIEKAKTIMERERALQLSQQDAMTLMTALDQPAKPNNKLQK
AASRYMDKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References