Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 1812971..1813746 | Replicon | chromosome |
Accession | NZ_OX460909 | ||
Organism | Photobacterium phosphoreum strain MIP2473 isolate MIP2473 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | QOS47_RS08545 | Protein ID | WP_279143375.1 |
Coordinates | 1813240..1813746 (+) | Length | 169 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | QOS47_RS08540 | Protein ID | WP_065209072.1 |
Coordinates | 1812971..1813243 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOS47_RS08500 | 1808089..1808403 | - | 315 | WP_045028698.1 | hypothetical protein | - |
QOS47_RS08505 | 1808819..1809130 | + | 312 | WP_065195290.1 | NIPSNAP family protein | - |
QOS47_RS08510 | 1809248..1809451 | + | 204 | Protein_1569 | phage integrase N-terminal SAM-like domain-containing protein | - |
QOS47_RS08515 | 1810010..1810357 | - | 348 | WP_045028701.1 | DUF3024 domain-containing protein | - |
QOS47_RS08520 | 1810480..1811325 | - | 846 | WP_107293668.1 | MBL fold metallo-hydrolase | - |
QOS47_RS08525 | 1811475..1811771 | - | 297 | WP_065195292.1 | hypothetical protein | - |
QOS47_RS08530 | 1811924..1812505 | - | 582 | WP_283597468.1 | HD domain-containing protein | - |
QOS47_RS08535 | 1812618..1812887 | + | 270 | Protein_1574 | phage integrase N-terminal SAM-like domain-containing protein | - |
QOS47_RS08540 | 1812971..1813243 | + | 273 | WP_065209072.1 | DUF1778 domain-containing protein | Antitoxin |
QOS47_RS08545 | 1813240..1813746 | + | 507 | WP_279143375.1 | GNAT family N-acetyltransferase | Toxin |
QOS47_RS08550 | 1813925..1814200 | + | 276 | Protein_1577 | site-specific integrase | - |
QOS47_RS08555 | 1814793..1815878 | + | 1086 | WP_283597469.1 | hypothetical protein | - |
QOS47_RS08560 | 1816075..1816347 | + | 273 | Protein_1579 | site-specific integrase | - |
QOS47_RS08565 | 1816801..1817046 | - | 246 | WP_105063926.1 | CopG family transcriptional regulator | - |
QOS47_RS08570 | 1817090..1817299 | - | 210 | WP_107293800.1 | BrnT family toxin | - |
QOS47_RS08575 | 1817537..1817785 | + | 249 | WP_012535627.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QOS47_RS08580 | 1817775..1818059 | + | 285 | WP_232611433.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QOS47_RS08585 | 1818210..1818527 | + | 318 | WP_283598093.1 | phage integrase N-terminal SAM-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1810010..1824163 | 14153 | |
- | inside | IScluster/Tn | - | - | 1813922..1820621 | 6699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 19009.84 Da Isoelectric Point: 7.4163
>T296993 WP_279143375.1 NZ_OX460909:1813240-1813746 [Photobacterium phosphoreum]
IMNTVQSEKAKHDRNRFDCGITALNNYLKVMASQQAKKDNTRTFVLEDKQYPEHIIGYYTLTMTPIDIQDLPPKLQKKHH
SVTSGGLIARLAVDHRYKGQGFGEWLLIDALRKLLMASETVAFPVVIVDAKDGAEDFYEKYGFTAFKDADNKLFITIADI
RASIGELI
IMNTVQSEKAKHDRNRFDCGITALNNYLKVMASQQAKKDNTRTFVLEDKQYPEHIIGYYTLTMTPIDIQDLPPKLQKKHH
SVTSGGLIARLAVDHRYKGQGFGEWLLIDALRKLLMASETVAFPVVIVDAKDGAEDFYEKYGFTAFKDADNKLFITIADI
RASIGELI
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|