Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 74523..75097 | Replicon | plasmid p81 |
Accession | NZ_OX458337 | ||
Organism | Pseudomonas syringae pv. tomato strain DAPP-PG 215 isolate IPVPG 215 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QWJ11_RS29460 | Protein ID | WP_007247235.1 |
Coordinates | 74523..74900 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q48BC4 |
Locus tag | QWJ11_RS29465 | Protein ID | WP_004644067.1 |
Coordinates | 74897..75097 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QWJ11_RS29440 (DAPPPG215_29780) | 69770..70372 | + | 603 | WP_007247239.1 | conjugal transfer protein TraX | - |
QWJ11_RS29445 (DAPPPG215_29785) | 70401..72542 | + | 2142 | WP_007247238.1 | DotA/TraY family protein | - |
QWJ11_RS29450 (DAPPPG215_29790) | 72591..73238 | + | 648 | WP_007247237.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
QWJ11_RS29455 (DAPPPG215_29795) | 73331..74533 | + | 1203 | WP_007247236.1 | hypothetical protein | - |
QWJ11_RS29460 (DAPPPG215_29800) | 74523..74900 | - | 378 | WP_007247235.1 | PIN domain-containing protein | Toxin |
QWJ11_RS29465 (DAPPPG215_29805) | 74897..75097 | - | 201 | WP_004644067.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QWJ11_RS29470 (DAPPPG215_29810) | 75190..76275 | + | 1086 | WP_007247234.1 | thioredoxin fold domain-containing protein | - |
QWJ11_RS29475 (DAPPPG215_29815) | 76262..78550 | + | 2289 | WP_007247233.1 | F-type conjugative transfer protein TrbC | - |
QWJ11_RS29480 (DAPPPG215_29820) | 78683..79000 | + | 318 | WP_223285740.1 | hypothetical protein | - |
QWJ11_RS29485 (DAPPPG215_29825) | 79021..79584 | + | 564 | WP_010214078.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..80904 | 80904 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13623.69 Da Isoelectric Point: 6.4723
>T296988 WP_007247235.1 NZ_OX458337:c74900-74523 [Pseudomonas syringae pv. tomato]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPSTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPSTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|