Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 5907918..5908437 Replicon chromosome
Accession NZ_OX458335
Organism Pseudomonas syringae pv. tomato strain DAPP-PG 215 isolate IPVPG 215

Toxin (Protein)


Gene name relE Uniprot ID F3IS01
Locus tag QWJ11_RS27105 Protein ID WP_005760789.1
Coordinates 5907918..5908208 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S6UWW5
Locus tag QWJ11_RS27110 Protein ID WP_002551444.1
Coordinates 5908198..5908437 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QWJ11_RS27080 (DAPPPG215_27370) 5904880..5905509 + 630 WP_007246586.1 NAD(P)H-dependent oxidoreductase -
QWJ11_RS27085 (DAPPPG215_27375) 5905566..5906180 - 615 WP_005769904.1 histidine phosphatase family protein -
QWJ11_RS27090 (DAPPPG215_27380) 5906258..5906599 - 342 WP_003380754.1 DUF5713 family protein -
QWJ11_RS27095 (DAPPPG215_27385) 5906954..5907691 + 738 WP_007246584.1 hypothetical protein -
QWJ11_RS27100 5907713..5907850 - 138 Protein_5340 GNAT family N-acetyltransferase -
QWJ11_RS27105 (DAPPPG215_27390) 5907918..5908208 - 291 WP_005760789.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QWJ11_RS27110 (DAPPPG215_27395) 5908198..5908437 - 240 WP_002551444.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QWJ11_RS27115 (DAPPPG215_27400) 5908613..5909074 - 462 WP_007246583.1 GNAT family N-acetyltransferase -
QWJ11_RS27120 (DAPPPG215_27405) 5909446..5909940 + 495 WP_010209025.1 hypothetical protein -
QWJ11_RS27125 (DAPPPG215_27410) 5909980..5911254 - 1275 WP_005769894.1 OprD family porin -
QWJ11_RS27130 (DAPPPG215_27415) 5911484..5911690 - 207 WP_044392902.1 hypothetical protein -
QWJ11_RS27135 (DAPPPG215_27420) 5911910..5913016 - 1107 WP_010209016.1 agmatine deiminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11095.92 Da        Isoelectric Point: 10.0984

>T296986 WP_005760789.1 NZ_OX458335:c5908208-5907918 [Pseudomonas syringae pv. tomato]
MTYSLEFDARALKEWGKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLSG

Download         Length: 291 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8955.34 Da        Isoelectric Point: 4.6017

>AT296986 WP_002551444.1 NZ_OX458335:c5908437-5908198 [Pseudomonas syringae pv. tomato]
MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLPFKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M3B8F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8M1G9

References