Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4438515..4439137 | Replicon | chromosome |
Accession | NZ_OX458335 | ||
Organism | Pseudomonas syringae pv. tomato strain DAPP-PG 215 isolate IPVPG 215 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q886E5 |
Locus tag | QWJ11_RS20510 | Protein ID | WP_011103638.1 |
Coordinates | 4438955..4439137 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q886E4 |
Locus tag | QWJ11_RS20505 | Protein ID | WP_005767619.1 |
Coordinates | 4438515..4438919 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QWJ11_RS20490 (DAPPPG215_20700) | 4434285..4434953 | + | 669 | WP_007245682.1 | ABC transporter ATP-binding protein | - |
QWJ11_RS20495 (DAPPPG215_20705) | 4434953..4437430 | + | 2478 | WP_010202744.1 | ABC transporter permease | - |
QWJ11_RS20500 (DAPPPG215_20710) | 4437420..4438499 | + | 1080 | WP_010202739.1 | lipocalin-like domain-containing protein | - |
QWJ11_RS20505 (DAPPPG215_20715) | 4438515..4438919 | - | 405 | WP_005767619.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QWJ11_RS20510 | 4438955..4439137 | - | 183 | WP_011103638.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QWJ11_RS20515 (DAPPPG215_20725) | 4439422..4441194 | + | 1773 | WP_007245686.1 | N-acetylglutaminylglutamine amidotransferase | - |
QWJ11_RS20520 (DAPPPG215_20730) | 4441198..4442946 | + | 1749 | WP_005767614.1 | N-acetylglutaminylglutamine synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.81 Da Isoelectric Point: 10.6643
>T296985 WP_011103638.1 NZ_OX458335:c4439137-4438955 [Pseudomonas syringae pv. tomato]
VQSRQLVKELEADGWVLDRVTGSHHMFKHPEKSQTVPVPHPKKDLPLGTVKAIRKLAGLA
VQSRQLVKELEADGWVLDRVTGSHHMFKHPEKSQTVPVPHPKKDLPLGTVKAIRKLAGLA
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14455.52 Da Isoelectric Point: 4.9093
>AT296985 WP_005767619.1 NZ_OX458335:c4438919-4438515 [Pseudomonas syringae pv. tomato]
MKYPICIEWGDETTAFGIQIPDIPGAITAGDTFEEAHAAAVEIAHIMLQEIAASGGSIPKVGTVAEHAKNPDFSGMGWGM
LEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
MKYPICIEWGDETTAFGIQIPDIPGAITAGDTFEEAHAAAVEIAHIMLQEIAASGGSIPKVGTVAEHAKNPDFSGMGWGM
LEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q886E5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3Z2W9 |