Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 2157672..2158185 | Replicon | chromosome |
Accession | NZ_OX458335 | ||
Organism | Pseudomonas syringae pv. tomato strain DAPP-PG 215 isolate IPVPG 215 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QWJ11_RS10260 | Protein ID | WP_007245247.1 |
Coordinates | 2157672..2157956 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S6UR83 |
Locus tag | QWJ11_RS10265 | Protein ID | WP_005740683.1 |
Coordinates | 2157946..2158185 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QWJ11_RS10240 (DAPPPG215_10330) | 2153081..2153566 | + | 486 | WP_007245243.1 | DUF2269 domain-containing protein | - |
QWJ11_RS10245 (DAPPPG215_10335) | 2153818..2155746 | + | 1929 | WP_007245244.1 | methyl-accepting chemotaxis protein | - |
QWJ11_RS10250 (DAPPPG215_10340) | 2155775..2156707 | - | 933 | WP_007245245.1 | DMT family transporter | - |
QWJ11_RS10255 (DAPPPG215_10345) | 2156782..2157636 | + | 855 | WP_007245246.1 | LysR family transcriptional regulator | - |
QWJ11_RS10260 | 2157672..2157956 | - | 285 | WP_007245247.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QWJ11_RS10265 (DAPPPG215_10350) | 2157946..2158185 | - | 240 | WP_005740683.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QWJ11_RS10270 (DAPPPG215_10355) | 2158354..2159370 | - | 1017 | WP_003376162.1 | 1-aminocyclopropane-1-carboxylate deaminase | - |
QWJ11_RS10275 (DAPPPG215_10360) | 2159536..2160042 | + | 507 | WP_007245249.1 | winged helix-turn-helix transcriptional regulator | - |
QWJ11_RS10280 (DAPPPG215_10365) | 2160190..2161098 | + | 909 | WP_010203521.1 | DUF808 domain-containing protein | - |
QWJ11_RS10285 (DAPPPG215_10370) | 2161225..2162010 | - | 786 | WP_007245250.1 | outer membrane protein OmpK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10828.58 Da Isoelectric Point: 10.0884
>T296984 WP_007245247.1 NZ_OX458335:c2157956-2157672 [Pseudomonas syringae pv. tomato]
MQVEWLKTALKNLDDEAAYISLENPAAAVAFVEAIQISVKQLASFPALGREGRIAGTREWPLPDWPYLIPYRIRNGRLQV
LRIFHTRRQSPLVW
MQVEWLKTALKNLDDEAAYISLENPAAAVAFVEAIQISVKQLASFPALGREGRIAGTREWPLPDWPYLIPYRIRNGRLQV
LRIFHTRRQSPLVW
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|