Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1096283..1096917 | Replicon | chromosome |
Accession | NZ_OX458335 | ||
Organism | Pseudomonas syringae pv. tomato strain DAPP-PG 215 isolate IPVPG 215 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QWJ11_RS05290 | Protein ID | WP_003380365.1 |
Coordinates | 1096283..1096687 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q888H8 |
Locus tag | QWJ11_RS05295 | Protein ID | WP_003380366.1 |
Coordinates | 1096687..1096917 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QWJ11_RS05260 (DAPPPG215_05290) | 1092169..1092651 | + | 483 | WP_002556144.1 | PAS domain-containing protein | - |
QWJ11_RS05265 (DAPPPG215_05295) | 1092747..1094003 | + | 1257 | WP_007244165.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
QWJ11_RS05270 (DAPPPG215_05300) | 1094025..1094687 | - | 663 | WP_005770944.1 | ChrR family anti-sigma-E factor | - |
QWJ11_RS05275 (DAPPPG215_05305) | 1094687..1095199 | - | 513 | WP_005615033.1 | sigma-70 family RNA polymerase sigma factor | - |
QWJ11_RS05280 (DAPPPG215_05310) | 1095260..1096099 | + | 840 | WP_225982956.1 | hypothetical protein | - |
QWJ11_RS05285 | 1096132..1096251 | - | 120 | Protein_1030 | aldose 1-epimerase | - |
QWJ11_RS05290 (DAPPPG215_05315) | 1096283..1096687 | - | 405 | WP_003380365.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QWJ11_RS05295 (DAPPPG215_05320) | 1096687..1096917 | - | 231 | WP_003380366.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QWJ11_RS05300 (DAPPPG215_05325) | 1097031..1097912 | - | 882 | WP_007244162.1 | aldose 1-epimerase | - |
QWJ11_RS05305 (DAPPPG215_05330) | 1097887..1098858 | - | 972 | WP_007244161.1 | DMT family transporter | - |
QWJ11_RS05310 (DAPPPG215_05335) | 1098942..1100222 | - | 1281 | WP_005736622.1 | TRAP transporter large permease | - |
QWJ11_RS05315 (DAPPPG215_05340) | 1100223..1100750 | - | 528 | WP_005770954.1 | TRAP transporter small permease | - |
QWJ11_RS05320 (DAPPPG215_05345) | 1100814..1101839 | - | 1026 | WP_005770956.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14814.09 Da Isoelectric Point: 6.8615
>T296983 WP_003380365.1 NZ_OX458335:c1096687-1096283 [Pseudomonas syringae pv. tomato]
MLKYMLDTNICIFTIKNKPVSVREAFNLHHGQLCISAITLMELVYGAEKSSSPERNLAVVEGFAARLELLPYDSAAAAHT
GMIRAELARAGTPIGPYDQMIAGHARSLGLVVITNNQREFQRVEGLRVEDWVSQ
MLKYMLDTNICIFTIKNKPVSVREAFNLHHGQLCISAITLMELVYGAEKSSSPERNLAVVEGFAARLELLPYDSAAAAHT
GMIRAELARAGTPIGPYDQMIAGHARSLGLVVITNNQREFQRVEGLRVEDWVSQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|