Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 467386..468425 | Replicon | chromosome |
| Accession | NZ_OX458335 | ||
| Organism | Pseudomonas syringae pv. tomato strain DAPP-PG 215 isolate IPVPG 215 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | QWJ11_RS02240 | Protein ID | WP_007244471.1 |
| Coordinates | 467850..468425 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | A0A2G9KX16 |
| Locus tag | QWJ11_RS02235 | Protein ID | WP_005737550.1 |
| Coordinates | 467386..467853 (+) | Length | 156 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QWJ11_RS02205 (DAPPPG215_02205) | 462535..463833 | + | 1299 | WP_007244474.1 | M20 family metallopeptidase | - |
| QWJ11_RS02210 (DAPPPG215_02210) | 464004..464597 | - | 594 | WP_007244473.1 | Sbal_3080 family lipoprotein | - |
| QWJ11_RS02215 (DAPPPG215_02215) | 464643..464906 | - | 264 | Protein_441 | hypothetical protein | - |
| QWJ11_RS02220 (DAPPPG215_02220) | 464955..465764 | - | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
| QWJ11_RS02225 (DAPPPG215_02225) | 465761..466783 | - | 1023 | WP_002551322.1 | IS21-like element ISPsy4 family transposase | - |
| QWJ11_RS02230 (DAPPPG215_02230) | 466869..467111 | - | 243 | Protein_444 | hypothetical protein | - |
| QWJ11_RS02235 (DAPPPG215_02235) | 467386..467853 | + | 468 | WP_005737550.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QWJ11_RS02240 (DAPPPG215_02240) | 467850..468425 | + | 576 | WP_007244471.1 | PIN domain-containing protein | Toxin |
| QWJ11_RS02245 (DAPPPG215_02245) | 468606..468857 | + | 252 | WP_005614049.1 | helix-turn-helix domain-containing protein | - |
| QWJ11_RS02250 (DAPPPG215_02250) | 468857..470053 | + | 1197 | WP_007244470.1 | type II toxin-antitoxin system HipA family toxin | - |
| QWJ11_RS02255 (DAPPPG215_02255) | 470217..470900 | + | 684 | WP_007244469.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QWJ11_RS02260 (DAPPPG215_02260) | 470958..471335 | + | 378 | WP_007244468.1 | lysozyme inhibitor LprI family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 467386..482036 | 14650 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21958.18 Da Isoelectric Point: 5.9343
>T296982 WP_007244471.1 NZ_OX458335:467850-468425 [Pseudomonas syringae pv. tomato]
MRHSPFTAFYDANVLYPAPLRDFLMHLALTGVYRARWSSQIHDEWKRNLLINRPELTREQLDRTSALMDKAVPDGLVSDY
QSLIEGLKLPDADDRHVLAAAIKCNASVIVTFKLKDFPKDVLDTFDMEPLHPDDFIADLWDLDKAAVLEAAQRQRASLRN
PAHSARQYLDKLLQQKLPETVKLLSDFEFLI
MRHSPFTAFYDANVLYPAPLRDFLMHLALTGVYRARWSSQIHDEWKRNLLINRPELTREQLDRTSALMDKAVPDGLVSDY
QSLIEGLKLPDADDRHVLAAAIKCNASVIVTFKLKDFPKDVLDTFDMEPLHPDDFIADLWDLDKAAVLEAAQRQRASLRN
PAHSARQYLDKLLQQKLPETVKLLSDFEFLI
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17233.75 Da Isoelectric Point: 5.2911
>AT296982 WP_005737550.1 NZ_OX458335:467386-467853 [Pseudomonas syringae pv. tomato]
MSSADATRTVLPGEKEIAAAVESSRQLAAFLTTKCDTQRIELVDETQQREVVELPMFALRLLGEILSELALGNAVKVVPI
HAELTTQEAADMLNVSRPHLVKMLDQGMLPHTKTGRHRRVKFADLMSYKQQRDQASREAMDELAAQAQELGMGYE
MSSADATRTVLPGEKEIAAAVESSRQLAAFLTTKCDTQRIELVDETQQREVVELPMFALRLLGEILSELALGNAVKVVPI
HAELTTQEAADMLNVSRPHLVKMLDQGMLPHTKTGRHRRVKFADLMSYKQQRDQASREAMDELAAQAQELGMGYE
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|