Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-AbrB |
Location | 1591730..1592294 | Replicon | chromosome |
Accession | NZ_OX458332 | ||
Organism | Methylococcus capsulatus isolate Mc(Nor) |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QMX71_RS07565 | Protein ID | WP_282213703.1 |
Coordinates | 1591730..1592074 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q602Q6 |
Locus tag | QMX71_RS07570 | Protein ID | WP_010962195.1 |
Coordinates | 1592064..1592294 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMX71_RS07560 (MCNOR_1593) | 1588743..1591733 | - | 2991 | WP_282213702.1 | DUF1156 domain-containing protein | - |
QMX71_RS07565 (MCNOR_1594) | 1591730..1592074 | - | 345 | WP_282213703.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QMX71_RS07570 (MCNOR_1595) | 1592064..1592294 | - | 231 | WP_010962195.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
QMX71_RS07575 (MCNOR_1596) | 1592337..1596002 | - | 3666 | WP_282213704.1 | helicase-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 11972.97 Da Isoelectric Point: 11.0291
>T296979 WP_282213703.1 NZ_OX458332:c1592074-1591730 [Methylococcus capsulatus]
VTYERGQVVRVPFPFTDRAASKNRPALVLSGASAFNTPAGHVVLAMITSAKNPPWPLDYPIEDLAAAGLPAPSVVRCKLF
TLDARLIRGVLGRLAAADAARANTALARLLGPLS
VTYERGQVVRVPFPFTDRAASKNRPALVLSGASAFNTPAGHVVLAMITSAKNPPWPLDYPIEDLAAAGLPAPSVVRCKLF
TLDARLIRGVLGRLAAADAARANTALARLLGPLS
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|