Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1836726..1837209 | Replicon | chromosome |
| Accession | NZ_OX458331 | ||
| Organism | Anaerococcus sp. Marseille-Q7828 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QNH69_RS08760 | Protein ID | WP_282930095.1 |
| Coordinates | 1836726..1836992 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QNH69_RS08765 | Protein ID | WP_282930096.1 |
| Coordinates | 1836982..1837209 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH69_RS08735 | 1832049..1832507 | - | 459 | WP_044565958.1 | hypothetical protein | - |
| QNH69_RS08740 | 1832491..1834305 | - | 1815 | WP_282930092.1 | 1,4-alpha-glucan branching protein GlgB | - |
| QNH69_RS08745 | 1834308..1834925 | - | 618 | WP_044565956.1 | uridine kinase | - |
| QNH69_RS08750 | 1834922..1835872 | - | 951 | WP_282930093.1 | NAD(P)-dependent oxidoreductase | - |
| QNH69_RS08755 | 1835950..1836456 | - | 507 | WP_282930094.1 | nucleoside deaminase | - |
| QNH69_RS08760 | 1836726..1836992 | - | 267 | WP_282930095.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QNH69_RS08765 | 1836982..1837209 | - | 228 | WP_282930096.1 | DUF6290 family protein | Antitoxin |
| QNH69_RS08775 | 1837864..1839072 | - | 1209 | WP_282930097.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| QNH69_RS08780 | 1839082..1839912 | - | 831 | WP_282930098.1 | aminoglycoside 6-adenylyltransferase | - |
| QNH69_RS08785 | 1839905..1840492 | - | 588 | WP_282930099.1 | CoA pyrophosphatase | - |
| QNH69_RS08790 | 1840595..1841008 | + | 414 | WP_282930100.1 | large conductance mechanosensitive channel protein MscL | - |
| QNH69_RS08795 | 1841133..1841504 | + | 372 | WP_282930101.1 | GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10353.27 Da Isoelectric Point: 10.6524
>T296977 WP_282930095.1 NZ_OX458331:c1836992-1836726 [Anaerococcus sp. Marseille-Q7828]
VTYSLVLSKNVRKTLKKMDRQVALMISKDMKNKLDGMENPRSFGKALTGDYKGLWRYRFGQYRVICDIRDDKLIILALEV
GHRKNIYK
VTYSLVLSKNVRKTLKKMDRQVALMISKDMKNKLDGMENPRSFGKALTGDYKGLWRYRFGQYRVICDIRDDKLIILALEV
GHRKNIYK
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|