Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1420757..1421419 | Replicon | chromosome |
| Accession | NZ_OX458331 | ||
| Organism | Anaerococcus sp. Marseille-Q7828 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QNH69_RS06765 | Protein ID | WP_282929738.1 |
| Coordinates | 1421225..1421419 (-) | Length | 65 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QNH69_RS06760 | Protein ID | WP_282929737.1 |
| Coordinates | 1420757..1421188 (-) | Length | 144 a.a. |
Genomic Context
Location: 1419860..1420360 (501 bp)
Type: Others
Protein ID: WP_084593708.1
Type: Others
Protein ID: WP_084593708.1
Location: 1416695..1417816 (1122 bp)
Type: Others
Protein ID: WP_282929735.1
Type: Others
Protein ID: WP_282929735.1
Location: 1417818..1418951 (1134 bp)
Type: Others
Protein ID: WP_282929736.1
Type: Others
Protein ID: WP_282929736.1
Location: 1420757..1421188 (432 bp)
Type: Antitoxin
Protein ID: WP_282929737.1
Type: Antitoxin
Protein ID: WP_282929737.1
Location: 1421225..1421419 (195 bp)
Type: Toxin
Protein ID: WP_282929738.1
Type: Toxin
Protein ID: WP_282929738.1
Location: 1421837..1423234 (1398 bp)
Type: Others
Protein ID: WP_282929739.1
Type: Others
Protein ID: WP_282929739.1
Location: 1423234..1425162 (1929 bp)
Type: Others
Protein ID: WP_282929740.1
Type: Others
Protein ID: WP_282929740.1
Location: 1425223..1426173 (951 bp)
Type: Others
Protein ID: WP_282929741.1
Type: Others
Protein ID: WP_282929741.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH69_RS06740 | 1416695..1417816 | - | 1122 | WP_282929735.1 | glucose-1-phosphate adenylyltransferase subunit GlgD | - |
| QNH69_RS06745 | 1417818..1418951 | - | 1134 | WP_282929736.1 | glucose-1-phosphate adenylyltransferase | - |
| QNH69_RS06755 | 1419860..1420360 | + | 501 | WP_084593708.1 | IS200/IS605 family transposase | - |
| QNH69_RS06760 | 1420757..1421188 | - | 432 | WP_282929737.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QNH69_RS06765 | 1421225..1421419 | - | 195 | WP_282929738.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QNH69_RS06770 | 1421837..1423234 | - | 1398 | WP_282929739.1 | glycoside hydrolase family 32 protein | - |
| QNH69_RS06775 | 1423234..1425162 | - | 1929 | WP_282929740.1 | sucrose-specific PTS transporter subunit IIBC | - |
| QNH69_RS06780 | 1425223..1426173 | - | 951 | WP_282929741.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1419887..1420360 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7072.32 Da Isoelectric Point: 10.6845
>T296976 WP_282929738.1 NZ_OX458331:c1421419-1421225 [Anaerococcus sp. Marseille-Q7828]
MPMTSKQMIKFLKKNGFTYVPSGDGSHKKFKNFETGKVTIVPDHGGKDLPKGTEHVILKQAGLK
MPMTSKQMIKFLKKNGFTYVPSGDGSHKKFKNFETGKVTIVPDHGGKDLPKGTEHVILKQAGLK
Download Length: 195 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 16325.61 Da Isoelectric Point: 4.3099
>AT296976 WP_282929737.1 NZ_OX458331:c1421188-1420757 [Anaerococcus sp. Marseille-Q7828]
MFVNYPALFLKEKDSDAFTVVFPDLQGCVTYGDSVNDALKMAQDALGAYLFEYYTKPNDIPKASSIDDIELKIDEEDKEY
FLYEGSFKNYVSLDLTDYVKKSSIKNVKKTLTIPSYLNEAGIENNINFSLLLQEALKKELKMI
MFVNYPALFLKEKDSDAFTVVFPDLQGCVTYGDSVNDALKMAQDALGAYLFEYYTKPNDIPKASSIDDIELKIDEEDKEY
FLYEGSFKNYVSLDLTDYVKKSSIKNVKKTLTIPSYLNEAGIENNINFSLLLQEALKKELKMI
Download Length: 432 bp