Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 976656..977216 | Replicon | chromosome |
Accession | NZ_OX458329 | ||
Organism | Mobiluncus sp. Marseille-Q7826 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QNH67_RS04180 | Protein ID | WP_282921656.1 |
Coordinates | 976944..977216 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QNH67_RS04175 | Protein ID | WP_282921655.1 |
Coordinates | 976656..976940 (+) | Length | 95 a.a. |
Genomic Context
Location: 976656..976940 (285 bp)
Type: Antitoxin
Protein ID: WP_282921655.1
Type: Antitoxin
Protein ID: WP_282921655.1
Location: 976944..977216 (273 bp)
Type: Toxin
Protein ID: WP_282921656.1
Type: Toxin
Protein ID: WP_282921656.1
Location: 973488..976172 (2685 bp)
Type: Others
Protein ID: WP_282921654.1
Type: Others
Protein ID: WP_282921654.1
Location: 977352..978242 (891 bp)
Type: Others
Protein ID: WP_282921657.1
Type: Others
Protein ID: WP_282921657.1
Location: 978493..979062 (570 bp)
Type: Others
Protein ID: WP_282921658.1
Type: Others
Protein ID: WP_282921658.1
Location: 979067..980311 (1245 bp)
Type: Others
Protein ID: WP_282921659.1
Type: Others
Protein ID: WP_282921659.1
Location: 980322..982157 (1836 bp)
Type: Others
Protein ID: WP_282921660.1
Type: Others
Protein ID: WP_282921660.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH67_RS04170 | 973488..976172 | - | 2685 | WP_282921654.1 | aconitate hydratase AcnA | - |
QNH67_RS04175 | 976656..976940 | + | 285 | WP_282921655.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QNH67_RS04180 | 976944..977216 | + | 273 | WP_282921656.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QNH67_RS04185 | 977352..978242 | - | 891 | WP_282921657.1 | hypothetical protein | - |
QNH67_RS04190 | 978493..979062 | - | 570 | WP_282921658.1 | GNAT family N-acetyltransferase | - |
QNH67_RS04195 | 979067..980311 | - | 1245 | WP_282921659.1 | TRAM domain-containing protein | - |
QNH67_RS04200 | 980322..982157 | - | 1836 | WP_282921660.1 | amino acid transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10443.13 Da Isoelectric Point: 8.9977
>T296975 WP_282921656.1 NZ_OX458329:976944-977216 [Mobiluncus sp. Marseille-Q7826]
MLELKTTAQFRKDYKRIKKRGYNLSLLQDVLETLCAEKPLDANYKDHALLGAYKGFRECHIQPDWLLIYTTDKDKLILVA
ARTGSHADLF
MLELKTTAQFRKDYKRIKKRGYNLSLLQDVLETLCAEKPLDANYKDHALLGAYKGFRECHIQPDWLLIYTTDKDKLILVA
ARTGSHADLF
Download Length: 273 bp