Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 976656..977216 | Replicon | chromosome |
| Accession | NZ_OX458329 | ||
| Organism | Mobiluncus sp. Marseille-Q7826 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QNH67_RS04180 | Protein ID | WP_282921656.1 |
| Coordinates | 976944..977216 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QNH67_RS04175 | Protein ID | WP_282921655.1 |
| Coordinates | 976656..976940 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH67_RS04170 | 973488..976172 | - | 2685 | WP_282921654.1 | aconitate hydratase AcnA | - |
| QNH67_RS04175 | 976656..976940 | + | 285 | WP_282921655.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QNH67_RS04180 | 976944..977216 | + | 273 | WP_282921656.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| QNH67_RS04185 | 977352..978242 | - | 891 | WP_282921657.1 | hypothetical protein | - |
| QNH67_RS04190 | 978493..979062 | - | 570 | WP_282921658.1 | GNAT family N-acetyltransferase | - |
| QNH67_RS04195 | 979067..980311 | - | 1245 | WP_282921659.1 | TRAM domain-containing protein | - |
| QNH67_RS04200 | 980322..982157 | - | 1836 | WP_282921660.1 | amino acid transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10443.13 Da Isoelectric Point: 8.9977
>T296975 WP_282921656.1 NZ_OX458329:976944-977216 [Mobiluncus sp. Marseille-Q7826]
MLELKTTAQFRKDYKRIKKRGYNLSLLQDVLETLCAEKPLDANYKDHALLGAYKGFRECHIQPDWLLIYTTDKDKLILVA
ARTGSHADLF
MLELKTTAQFRKDYKRIKKRGYNLSLLQDVLETLCAEKPLDANYKDHALLGAYKGFRECHIQPDWLLIYTTDKDKLILVA
ARTGSHADLF
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|