Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 462654..463126 Replicon chromosome
Accession NZ_OX458329
Organism Mobiluncus sp. Marseille-Q7826

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QNH67_RS01880 Protein ID WP_282921237.1
Coordinates 462654..462854 (-) Length 67 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QNH67_RS01885 Protein ID WP_282921238.1
Coordinates 462851..463126 (-) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH67_RS01860 460023..461378 + 1356 WP_282921233.1 AAA family ATPase -
QNH67_RS01865 461565..461813 + 249 WP_282921234.1 CopG family transcriptional regulator -
QNH67_RS01870 461947..462252 - 306 WP_282921235.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
QNH67_RS01875 462249..462590 - 342 WP_282921236.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
QNH67_RS01880 462654..462854 - 201 WP_282921237.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QNH67_RS01885 462851..463126 - 276 WP_282921238.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QNH67_RS01890 463292..463783 - 492 WP_282921239.1 hypothetical protein -
QNH67_RS01895 463995..464135 + 141 Protein_367 RhuM family protein -
QNH67_RS01900 464516..465745 - 1230 WP_282921240.1 polysaccharide deacetylase family protein -
QNH67_RS01905 465889..466221 - 333 WP_282921241.1 DUF2283 domain-containing protein -
QNH67_RS01910 466233..466463 - 231 WP_282921242.1 DUF4258 domain-containing protein -
QNH67_RS01915 466460..466867 - 408 WP_282921243.1 hypothetical protein -
QNH67_RS01920 467256..467636 - 381 WP_282921244.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-57)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-77)


Sequences

Toxin        


Download         Length: 67 a.a.        Molecular weight: 7307.25 Da        Isoelectric Point: 10.0952

>T296974 WP_282921237.1 NZ_OX458329:c462854-462654 [Mobiluncus sp. Marseille-Q7826]
VSLRVVLSNRFKKDLKLAKKRGLDLELLNSVVTHLASGNTLDAKYRDHDLGGNYATFTDEASRSTS

Download         Length: 201 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10318.74 Da        Isoelectric Point: 4.5859

>AT296974 WP_282921238.1 NZ_OX458329:c463126-462851 [Mobiluncus sp. Marseille-Q7826]
MTKVSTNINLDADLKRSAQELLKDLGMDLTTAVTIFLRQTVRDQGIPFRITRDIPNAETLAALQEYEAMKAHPEQYKSYA
NFQEAMEDVLA

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References