Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 166203..166753 | Replicon | chromosome |
| Accession | NZ_OX458329 | ||
| Organism | Mobiluncus sp. Marseille-Q7826 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QNH67_RS00650 | Protein ID | WP_282921010.1 |
| Coordinates | 166203..166484 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QNH67_RS00655 | Protein ID | WP_282921011.1 |
| Coordinates | 166481..166753 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH67_RS00640 | 161415..164477 | + | 3063 | WP_282921008.1 | glycoside hydrolase family 2 TIM barrel-domain containing protein | - |
| QNH67_RS00645 | 164490..166013 | + | 1524 | WP_282921009.1 | MFS transporter | - |
| QNH67_RS00650 | 166203..166484 | - | 282 | WP_282921010.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| QNH67_RS00655 | 166481..166753 | - | 273 | WP_282921011.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QNH67_RS00660 | 166894..167586 | - | 693 | WP_282921012.1 | class I SAM-dependent methyltransferase | - |
| QNH67_RS00665 | 168209..168757 | + | 549 | WP_282921013.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| QNH67_RS00670 | 169256..170560 | - | 1305 | WP_282921014.1 | chorismate-binding protein | - |
| QNH67_RS00675 | 170904..171263 | + | 360 | WP_282921015.1 | NADH-quinone oxidoreductase subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10979.81 Da Isoelectric Point: 9.7706
>T296973 WP_282921010.1 NZ_OX458329:c166484-166203 [Mobiluncus sp. Marseille-Q7826]
MKYEVRFTSQFKKDVKLAKKQHRDLEKLFKVIQILAEGGSLPERYRDHGLSGTFAGTRECHIEPDWLLIYEIRSNVLVLM
LYRLGTHAELFQK
MKYEVRFTSQFKKDVKLAKKQHRDLEKLFKVIQILAEGGSLPERYRDHGLSGTFAGTRECHIEPDWLLIYEIRSNVLVLM
LYRLGTHAELFQK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|