Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3543852..3544428 | Replicon | chromosome |
| Accession | NZ_OX442412 | ||
| Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | QM550_RS17425 | Protein ID | WP_001131963.1 |
| Coordinates | 3543852..3544139 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
| Locus tag | QM550_RS17430 | Protein ID | WP_000063143.1 |
| Coordinates | 3544126..3544428 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM550_RS17415 (3538962) | 3538962..3542471 | - | 3510 | WP_023138516.1 | type I restriction-modification system endonuclease | - |
| QM550_RS17420 (3542669) | 3542669..3543583 | + | 915 | WP_023138517.1 | restriction endonuclease | - |
| QM550_RS17425 (3543852) | 3543852..3544139 | + | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| QM550_RS17430 (3544126) | 3544126..3544428 | + | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
| QM550_RS17435 (3544503) | 3544503..3545459 | - | 957 | WP_000187840.1 | GTPase | - |
| QM550_RS17440 (3545470) | 3545470..3545673 | - | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| QM550_RS17445 (3545768) | 3545768..3547918 | - | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T296970 WP_001131963.1 NZ_OX442412:3543852-3544139 [Salmonella enterica subsp. enterica serovar Rissen]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT296970 WP_000063143.1 NZ_OX442412:3544126-3544428 [Salmonella enterica subsp. enterica serovar Rissen]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|