Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 3495611..3496161 | Replicon | chromosome |
| Accession | NZ_OX442412 | ||
| Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | QM550_RS17240 | Protein ID | WP_001199743.1 |
| Coordinates | 3495853..3496161 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | QM550_RS17235 | Protein ID | WP_001118105.1 |
| Coordinates | 3495611..3495850 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM550_RS17190 (3490660) | 3490660..3490863 | + | 204 | WP_023137300.1 | hypothetical protein | - |
| QM550_RS17195 (3490928) | 3490928..3491842 | + | 915 | WP_023138490.1 | hypothetical protein | - |
| QM550_RS17200 (3491927) | 3491927..3492748 | + | 822 | WP_023138491.1 | DUF932 domain-containing protein | - |
| QM550_RS17205 (3492761) | 3492761..3493261 | + | 501 | WP_023138492.1 | DNA repair protein RadC | - |
| QM550_RS17210 (3493258) | 3493258..3493479 | + | 222 | WP_023138493.1 | DUF987 family protein | - |
| QM550_RS17215 (3493502) | 3493502..3493843 | + | 342 | WP_023138494.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| QM550_RS17220 (3493887) | 3493887..3494228 | + | 342 | WP_023138495.1 | TA system toxin CbtA family protein | - |
| QM550_RS17225 (3494344) | 3494344..3495177 | + | 834 | WP_023138496.1 | DUF4942 domain-containing protein | - |
| QM550_RS17230 (3495254) | 3495254..3495502 | + | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
| QM550_RS17235 (3495611) | 3495611..3495850 | + | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| QM550_RS17240 (3495853) | 3495853..3496161 | + | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| QM550_RS17245 (3496285) | 3496285..3497267 | - | 983 | Protein_3361 | IS3 family transposase | - |
| QM550_RS17250 (3497334) | 3497334..3498351 | + | 1018 | Protein_3362 | IS110 family transposase | - |
| QM550_RS17255 (3498577) | 3498577..3498693 | - | 117 | Protein_3363 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T296969 WP_001199743.1 NZ_OX442412:3495853-3496161 [Salmonella enterica subsp. enterica serovar Rissen]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |