Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3495611..3496161 Replicon chromosome
Accession NZ_OX442412
Organism Salmonella enterica subsp. enterica serovar Rissen isolate pure strain

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag QM550_RS17240 Protein ID WP_001199743.1
Coordinates 3495853..3496161 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag QM550_RS17235 Protein ID WP_001118105.1
Coordinates 3495611..3495850 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM550_RS17190 (3490660) 3490660..3490863 + 204 WP_023137300.1 hypothetical protein -
QM550_RS17195 (3490928) 3490928..3491842 + 915 WP_023138490.1 hypothetical protein -
QM550_RS17200 (3491927) 3491927..3492748 + 822 WP_023138491.1 DUF932 domain-containing protein -
QM550_RS17205 (3492761) 3492761..3493261 + 501 WP_023138492.1 DNA repair protein RadC -
QM550_RS17210 (3493258) 3493258..3493479 + 222 WP_023138493.1 DUF987 family protein -
QM550_RS17215 (3493502) 3493502..3493843 + 342 WP_023138494.1 type IV toxin-antitoxin system YeeU family antitoxin -
QM550_RS17220 (3493887) 3493887..3494228 + 342 WP_023138495.1 TA system toxin CbtA family protein -
QM550_RS17225 (3494344) 3494344..3495177 + 834 WP_023138496.1 DUF4942 domain-containing protein -
QM550_RS17230 (3495254) 3495254..3495502 + 249 WP_000168385.1 ribbon-helix-helix domain-containing protein -
QM550_RS17235 (3495611) 3495611..3495850 + 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QM550_RS17240 (3495853) 3495853..3496161 + 309 WP_001199743.1 CcdB family protein Toxin
QM550_RS17245 (3496285) 3496285..3497267 - 983 Protein_3361 IS3 family transposase -
QM550_RS17250 (3497334) 3497334..3498351 + 1018 Protein_3362 IS110 family transposase -
QM550_RS17255 (3498577) 3498577..3498693 - 117 Protein_3363 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T296969 WP_001199743.1 NZ_OX442412:3495853-3496161 [Salmonella enterica subsp. enterica serovar Rissen]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT296969 WP_001118105.1 NZ_OX442412:3495611-3495850 [Salmonella enterica subsp. enterica serovar Rissen]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References