Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 3493502..3494228 Replicon chromosome
Accession NZ_OX442412
Organism Salmonella enterica subsp. enterica serovar Rissen isolate pure strain

Toxin (Protein)


Gene name ykfI Uniprot ID A0A5T2TVB7
Locus tag QM550_RS17220 Protein ID WP_023138495.1
Coordinates 3493887..3494228 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A5T2TUW7
Locus tag QM550_RS17215 Protein ID WP_023138494.1
Coordinates 3493502..3493843 (+) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM550_RS17175 (3489063) 3489063..3489356 + 294 WP_023138487.1 hypothetical protein -
QM550_RS17180 (3489711) 3489711..3490424 + 714 WP_023138489.1 WYL domain-containing protein -
QM550_RS17185 (3490425) 3490425..3490643 + 219 WP_000928654.1 hypothetical protein -
QM550_RS17190 (3490660) 3490660..3490863 + 204 WP_023137300.1 hypothetical protein -
QM550_RS17195 (3490928) 3490928..3491842 + 915 WP_023138490.1 hypothetical protein -
QM550_RS17200 (3491927) 3491927..3492748 + 822 WP_023138491.1 DUF932 domain-containing protein -
QM550_RS17205 (3492761) 3492761..3493261 + 501 WP_023138492.1 DNA repair protein RadC -
QM550_RS17210 (3493258) 3493258..3493479 + 222 WP_023138493.1 DUF987 family protein -
QM550_RS17215 (3493502) 3493502..3493843 + 342 WP_023138494.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QM550_RS17220 (3493887) 3493887..3494228 + 342 WP_023138495.1 TA system toxin CbtA family protein Toxin
QM550_RS17225 (3494344) 3494344..3495177 + 834 WP_023138496.1 DUF4942 domain-containing protein -
QM550_RS17230 (3495254) 3495254..3495502 + 249 WP_000168385.1 ribbon-helix-helix domain-containing protein -
QM550_RS17235 (3495611) 3495611..3495850 + 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin -
QM550_RS17240 (3495853) 3495853..3496161 + 309 WP_001199743.1 CcdB family protein -
QM550_RS17245 (3496285) 3496285..3497267 - 983 Protein_3361 IS3 family transposase -
QM550_RS17250 (3497334) 3497334..3498351 + 1018 Protein_3362 IS110 family transposase -
QM550_RS17255 (3498577) 3498577..3498693 - 117 Protein_3363 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(2-109)

Antitoxin

Antitoxin CbeA

(11-109)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13132.05 Da        Isoelectric Point: 9.7617

>T296968 WP_023138495.1 NZ_OX442412:3493887-3494228 [Salmonella enterica subsp. enterica serovar Rissen]
MQTQYNHPHRATPSQLSPVEIWQKLLTHLLAKHYGLELSDTPFSVEKVIQEHIDAGITLANAVNFIVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRRQRYLAAH

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12690.40 Da        Isoelectric Point: 6.2121

>AT296968 WP_023138494.1 NZ_OX442412:3493502-3493843 [Salmonella enterica subsp. enterica serovar Rissen]
MDTNETQSTPVWGLRNDVFPSFGARLVQEGNHLHYLADRAGIYGEFTPAQLQTLDVVFPMFIKHMEAALRTGALNPREAR
RFTTELRGITCEADTCGSFGYVYLSLYPTIVKS

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T2TVB7

Antitoxin

Source ID Structure
AlphaFold DB A0A5T2TUW7

References