Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3432505..3433021 | Replicon | chromosome |
| Accession | NZ_OX442412 | ||
| Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | QM550_RS16905 | Protein ID | WP_000220578.1 |
| Coordinates | 3432737..3433021 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | QM550_RS16900 | Protein ID | WP_000212724.1 |
| Coordinates | 3432505..3432747 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM550_RS16880 (3427525) | 3427525..3428658 | + | 1134 | WP_023138829.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| QM550_RS16885 (3428642) | 3428642..3429760 | + | 1119 | WP_023138828.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| QM550_RS16890 (3429757) | 3429757..3430497 | + | 741 | WP_023138827.1 | KDGP aldolase family protein | - |
| QM550_RS16895 (3430514) | 3430514..3432427 | + | 1914 | WP_023203318.1 | BglG family transcription antiterminator | - |
| QM550_RS16900 (3432505) | 3432505..3432747 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QM550_RS16905 (3432737) | 3432737..3433021 | + | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM550_RS16910 (3433025) | 3433025..3433489 | - | 465 | WP_017441190.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QM550_RS16915 (3433706) | 3433706..3435844 | - | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QM550_RS16920 (3436253) | 3436253..3437905 | - | 1653 | WP_023138463.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T296967 WP_000220578.1 NZ_OX442412:3432737-3433021 [Salmonella enterica subsp. enterica serovar Rissen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |