Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2391484..2392070 Replicon chromosome
Accession NZ_OX442412
Organism Salmonella enterica subsp. enterica serovar Rissen isolate pure strain

Toxin (Protein)


Gene name doc Uniprot ID A0A5T2TYR8
Locus tag QM550_RS12030 Protein ID WP_023138592.1
Coordinates 2391484..2391852 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag QM550_RS12035 Protein ID WP_001520924.1
Coordinates 2391849..2392070 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM550_RS12010 (2387003) 2387003..2388073 - 1071 WP_001646570.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
QM550_RS12015 (2388075) 2388075..2388920 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QM550_RS12020 (2388917) 2388917..2389804 - 888 WP_023138593.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QM550_RS12025 (2389909) 2389909..2391225 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QM550_RS12030 (2391484) 2391484..2391852 - 369 WP_023138592.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QM550_RS12035 (2391849) 2391849..2392070 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QM550_RS12040 (2392202) 2392202..2392915 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QM550_RS12045 (2392917) 2392917..2393684 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QM550_RS12050 (2393681) 2393681..2394958 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
QM550_RS12055 (2394955) 2394955..2395881 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QM550_RS12060 (2395941) 2395941..2397050 - 1110 WP_000822977.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2386266..2394958 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(25-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13563.81 Da        Isoelectric Point: 6.7252

>T296964 WP_023138592.1 NZ_OX442412:c2391852-2391484 [Salmonella enterica subsp. enterica serovar Rissen]
MTLQLISAEEIIQFHDRLLRVTPGVTGMSDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT296964 WP_001520924.1 NZ_OX442412:c2392070-2391849 [Salmonella enterica subsp. enterica serovar Rissen]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T2TYR8

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References