Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2391484..2392070 | Replicon | chromosome |
| Accession | NZ_OX442412 | ||
| Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A5T2TYR8 |
| Locus tag | QM550_RS12030 | Protein ID | WP_023138592.1 |
| Coordinates | 2391484..2391852 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | QM550_RS12035 | Protein ID | WP_001520924.1 |
| Coordinates | 2391849..2392070 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM550_RS12010 (2387003) | 2387003..2388073 | - | 1071 | WP_001646570.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| QM550_RS12015 (2388075) | 2388075..2388920 | - | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| QM550_RS12020 (2388917) | 2388917..2389804 | - | 888 | WP_023138593.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| QM550_RS12025 (2389909) | 2389909..2391225 | - | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| QM550_RS12030 (2391484) | 2391484..2391852 | - | 369 | WP_023138592.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QM550_RS12035 (2391849) | 2391849..2392070 | - | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QM550_RS12040 (2392202) | 2392202..2392915 | - | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| QM550_RS12045 (2392917) | 2392917..2393684 | - | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QM550_RS12050 (2393681) | 2393681..2394958 | - | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| QM550_RS12055 (2394955) | 2394955..2395881 | - | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QM550_RS12060 (2395941) | 2395941..2397050 | - | 1110 | WP_000822977.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2386266..2394958 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13563.81 Da Isoelectric Point: 6.7252
>T296964 WP_023138592.1 NZ_OX442412:c2391852-2391484 [Salmonella enterica subsp. enterica serovar Rissen]
MTLQLISAEEIIQFHDRLLRVTPGVTGMSDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMSDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T2TYR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |