Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2005813..2006433 | Replicon | chromosome |
Accession | NZ_OX442412 | ||
Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | QM550_RS10135 | Protein ID | WP_001280991.1 |
Coordinates | 2006215..2006433 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | QM550_RS10130 | Protein ID | WP_000344807.1 |
Coordinates | 2005813..2006187 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM550_RS10120 (2000952) | 2000952..2002145 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QM550_RS10125 (2002168) | 2002168..2005317 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
QM550_RS10130 (2005813) | 2005813..2006187 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
QM550_RS10135 (2006215) | 2006215..2006433 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
QM550_RS10140 (2006612) | 2006612..2007163 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
QM550_RS10145 (2007281) | 2007281..2007751 | + | 471 | WP_000136183.1 | YlaC family protein | - |
QM550_RS10150 (2007806) | 2007806..2007946 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
QM550_RS10155 (2007952) | 2007952..2008212 | - | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
QM550_RS10160 (2008437) | 2008437..2009987 | + | 1551 | WP_000213144.1 | EAL domain-containing protein | - |
QM550_RS10170 (2010218) | 2010218..2010607 | + | 390 | WP_000961285.1 | MGMT family protein | - |
QM550_RS10175 (2010640) | 2010640..2011209 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T296963 WP_001280991.1 NZ_OX442412:2006215-2006433 [Salmonella enterica subsp. enterica serovar Rissen]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT296963 WP_000344807.1 NZ_OX442412:2005813-2006187 [Salmonella enterica subsp. enterica serovar Rissen]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|