Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 651245..651767 | Replicon | chromosome |
| Accession | NZ_OX442412 | ||
| Organism | Salmonella enterica subsp. enterica serovar Rissen isolate pure strain | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | QM550_RS03360 | Protein ID | WP_000221345.1 |
| Coordinates | 651245..651529 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | QM550_RS03365 | Protein ID | WP_000885424.1 |
| Coordinates | 651519..651767 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM550_RS03340 (647320) | 647320..648828 | - | 1509 | WP_023138146.1 | FAD-dependent oxidoreductase | - |
| QM550_RS03345 (648873) | 648873..649361 | + | 489 | WP_023138147.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| QM550_RS03350 (649554) | 649554..650627 | + | 1074 | WP_023138148.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| QM550_RS03355 (650685) | 650685..651074 | - | 390 | WP_000194089.1 | RidA family protein | - |
| QM550_RS03360 (651245) | 651245..651529 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM550_RS03365 (651519) | 651519..651767 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QM550_RS03370 (652180) | 652180..652533 | - | 354 | WP_000418733.1 | hypothetical protein | - |
| QM550_RS03375 (652536) | 652536..652925 | - | 390 | WP_001044696.1 | hypothetical protein | - |
| QM550_RS03380 (653290) | 653290..653397 | + | 108 | Protein_664 | IS110 family transposase | - |
| QM550_RS03385 (653804) | 653804..654136 | + | 333 | WP_023138149.1 | DUF1493 family protein | - |
| QM550_RS03390 (654411) | 654411..654599 | - | 189 | WP_001276021.1 | DUF29 family protein | - |
| QM550_RS03395 (655012) | 655012..655920 | + | 909 | WP_023138150.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 648873..658792 | 9919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T296957 WP_000221345.1 NZ_OX442412:c651529-651245 [Salmonella enterica subsp. enterica serovar Rissen]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |